![Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining in human liver and lymph node tissues using anti-ACOX2 antibody. Corresponding ACOX2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ACOX2-Antibody-Immunohistochemistry-Paraffin-NBP2-57292-img0005.jpg "Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining in human liver and lymph node tissues using anti-ACOX2 antibody. Corresponding ACOX2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VTVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACOX2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ACOX2 |
![Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human colon, liver, lymph node and testis using Anti-ACOX2 antibody NBP2-57292 (A) shows similar protein distribution across tissues to independent antibody NBP1-88364 (B).](http://images.novusbio.com/fullsize/ACOX2-Antibody-Immunohistochemistry-Paraffin-NBP2-57292-img0007.jpg "Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human colon, liver, lymph node and testis using Anti-ACOX2 antibody NBP2-57292 (A) shows similar protein distribution across tissues to independent antibody NBP1-88364 (B).")
![Western Blot: ACOX2 Antibody [NBP2-57292] - Western blot analysis in control (vector only transfected HEK293T lysate) and ACOX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/ACOX2-Antibody-Western-Blot-NBP2-57292-img0002.jpg "Western Blot: ACOX2 Antibody [NBP2-57292] - Western blot analysis in control (vector only transfected HEK293T lysate) and ACOX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: ACOX2 Antibody [NBP2-57292] - Staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ACOX2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57292-img0006.jpg "Immunocytochemistry/Immunofluorescence: ACOX2 Antibody [NBP2-57292] - Staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human testis.](http://images.novusbio.com/fullsize/ACOX2-Antibody-Immunohistochemistry-Paraffin-NBP2-57292-img0009.jpg "Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human testis.")
![Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human liver shows high expression.](http://images.novusbio.com/fullsize/ACOX2-Antibody-Immunohistochemistry-Paraffin-NBP2-57292-img0003.jpg "Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human liver shows high expression.")
![Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/ACOX2-Antibody-Immunohistochemistry-Paraffin-NBP2-57292-img0004.jpg "Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human colon.](http://images.novusbio.com/fullsize/ACOX2-Antibody-Immunohistochemistry-Paraffin-NBP2-57292-img0008.jpg "Immunohistochemistry-Paraffin: ACOX2 Antibody [NBP2-57292] - Staining of human colon.")
![Immunocytochemistry CYP7A1 Antibody (946902) [Unconjugated]](https://images.novusbio.com/images2/CYP7A1_MAB9120_Immunocytochemistry__Immunofluorescence_19938.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")