Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, IHC |
Clone | 6M8I5 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Additional Information | Recombinant Monoclonal Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 236-335 of human DNA Polymerase beta (P06746). MGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | POLB |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Theoretical MW | 42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DNA Polymerase beta Antibody (NBP3-16127)Find related products by research area.
|
PARP Antibody Assays aid both Apoptosis and Cancer Research The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | POLB |