![Western Blot: dedicator of cytokinesis 8 Antibody [NBP3-17049] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil](http://images.novusbio.com/fullsize/dedicator-of-cytokinesis-8-Antibody-Western-Blot-NBP3-17049-img0004.jpg "Western Blot: dedicator of cytokinesis 8 Antibody [NBP3-17049] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: INRYSSAEIRKQFTLPPNLGQYHRQSISTSGFPSLQLPQFYDPVEPVDFEGLLMTHLNSLDVQLAQELGDFTDDDLDVVF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DOCK8 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for dedicator of cytokinesis 8 Antibody (NBP3-17049)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DOCK8 |
![Immunohistochemistry-Paraffin: dedicator of cytokinesis 8 Antibody [NBP3-17049] - Staining of human lymph node shows high expression.](http://images.novusbio.com/fullsize/dedicator-of-cytokinesis-8-Antibody-Immunohistochemistry-Paraffin-NBP3-17049-img0003.jpg "Immunohistochemistry-Paraffin: dedicator of cytokinesis 8 Antibody [NBP3-17049] - Staining of human lymph node shows high expression.")
![Immunohistochemistry-Paraffin: dedicator of cytokinesis 8 Antibody [NBP3-17049] - Analysis in human lymph node and endometrium tissues using Anti-DOCK8 antibody. Corresponding DOCK8 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/dedicator-of-cytokinesis-8-Antibody-Immunohistochemistry-Paraffin-NBP3-17049-img0001.jpg "Immunohistochemistry-Paraffin: dedicator of cytokinesis 8 Antibody [NBP3-17049] - Analysis in human lymph node and endometrium tissues using Anti-DOCK8 antibody. Corresponding DOCK8 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: dedicator of cytokinesis 8 Antibody [NBP3-17049] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/dedicator-of-cytokinesis-8-Antibody-Immunohistochemistry-Paraffin-NBP3-17049-img0002.jpg "Immunohistochemistry-Paraffin: dedicator of cytokinesis 8 Antibody [NBP3-17049] - Staining of human endometrium shows low expression as expected.")
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Simple_Western_21000.jpg)
![Western Blot STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Western_Blot_5993.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Knockout_Validated_21531.jpg)
![Western Blot Tyk2 Antibody (307214) [Unconjugated]](https://images.novusbio.com/images2/Tyk2_MAB3427_Western_Blot_6105.jpg)
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")