![Western Blot: Decorin Antibody [NBP1-57923] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta](http://images.novusbio.com/fullsize/Decorin-Antibody-Western-Blot-NBP1-57923-img0006.jpg "Western Blot: Decorin Antibody [NBP1-57923] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta")
| Reactivity | Hu, CaSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to DCN(decorin) The peptide sequence was selected from the N terminal of DCN. Peptide sequence IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DCN |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This Decorin Antibody is validated for ICC/IF from a verified customer review. |
|
| Theoretical MW | 36 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunocytochemistry__Immunofluorescence_23325.jpg)
![Neutralization Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Block_Neutralize_8975.jpg)
![Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunohistochemistry_9333.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Publication using NBP1-57923 | Applications | Species |
|---|---|---|
| Erwin WM, DeSouza L, Funabashi M et al. The biological basis of degenerative disc disease: proteomic and biomechanical analysis of the canine intervertebral disc. Arthritis Res. Ther. 2015-09-05 [PMID: 26341258] (WB, Canine) | WB | Canine |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Catherine Heyward |
ICC | Human | 07/29/2021 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Decorin Antibody (NBP1-57923)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: Decorin Antibody [NBP1-57923] - Comparative immunohistochemical analysis of non-chondrodystrophic (NCD) and chondrodystrophic (CD) canine nucleus pulposus (NP) expression and distribution of decorin. For all extracellular matrix (ECM) proteins, the NCD canine intervertebral disc NP reveals a cobweb appearance, demonstrating intense staining for all proteins located in the areas tightly between the cells. The overall appearance of the CD NP bears a strong resemblance to a fibrocartilaginous phenotype that is distinctly different from the NCD canine NP. Image collected and cropped by CiteAb from the following publication (//arthritis-research.com/content/17/1/240) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Decorin-Antibody-Immunohistochemistry-NBP1-57923-img0010.jpg "Immunohistochemistry: Decorin Antibody [NBP1-57923] - Comparative immunohistochemical analysis of non-chondrodystrophic (NCD) and chondrodystrophic (CD) canine nucleus pulposus (NP) expression and distribution of decorin. For all extracellular matrix (ECM) proteins, the NCD canine intervertebral disc NP reveals a cobweb appearance, demonstrating intense staining for all proteins located in the areas tightly between the cells. The overall appearance of the CD NP bears a strong resemblance to a fibrocartilaginous phenotype that is distinctly different from the NCD canine NP. Image collected and cropped by CiteAb from the following publication (//arthritis-research.com/content/17/1/240) licensed under a CC-BY license.")
![Western Blot: Decorin Antibody [NBP1-57923] - Western blots depicting the expression of decorin after proteoglycan extraction from non-chondrodystrophic (NCD) and chondrodystrophic (CD) canine intervertebral disc (IVD) nucleus pulposus (NP). Lane (a) is undigested (U) proteoglycan extract from NCD (mongrel) and lane (c) is from CD (beagle) canine NP. Lanes (b) & (d) depict the detection of the specific small leucine-rich proteoglycan (SLRP) indicated above after digestion (D) with chondroitinase ABC and keratinase in NCD canine (lane b) and CD canine (lane d). Decorin core protein is visualized at 43 kDa after digestion (lane b), with a clear, single band found from NCD NP extracts. NP extracts from CD canines (lane d) reveal fragmentation of decorin with multiple lower MW bands visualized at 30, 25-20, and 17-15 kDa. Image collected and cropped by CiteAb from the following publication (//arthritis-research.com/content/17/1/240) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Decorin-Antibody-Western-Blot-NBP1-57923-img0008.jpg "Western Blot: Decorin Antibody [NBP1-57923] - Western blots depicting the expression of decorin after proteoglycan extraction from non-chondrodystrophic (NCD) and chondrodystrophic (CD) canine intervertebral disc (IVD) nucleus pulposus (NP). Lane (a) is undigested (U) proteoglycan extract from NCD (mongrel) and lane (c) is from CD (beagle) canine NP. Lanes (b) & (d) depict the detection of the specific small leucine-rich proteoglycan (SLRP) indicated above after digestion (D) with chondroitinase ABC and keratinase in NCD canine (lane b) and CD canine (lane d). Decorin core protein is visualized at 43 kDa after digestion (lane b), with a clear, single band found from NCD NP extracts. NP extracts from CD canines (lane d) reveal fragmentation of decorin with multiple lower MW bands visualized at 30, 25-20, and 17-15 kDa. Image collected and cropped by CiteAb from the following publication (//arthritis-research.com/content/17/1/240) licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: Decorin Antibody [NBP1-57923] - Human periodontal ligament cells stained with rabbit anti-decorin 1:300 and goat anti-rabbit Alexa 488 1:500. Nuclei stained with DAPI. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/fullsize/Decorin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-57923-img0012.jpg "Immunocytochemistry/Immunofluorescence: Decorin Antibody [NBP1-57923] - Human periodontal ligament cells stained with rabbit anti-decorin 1:300 and goat anti-rabbit Alexa 488 1:500. Nuclei stained with DAPI. ICC/IF image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: Decorin Antibody [NBP1-57923] - Human skin tissue at an antibody concentration of 4-8 ug/mL.](http://images.novusbio.com/fullsize/Decorin-Antibody-Immunohistochemistry-Paraffin-NBP1-57923-img0005.jpg "Immunohistochemistry-Paraffin: Decorin Antibody [NBP1-57923] - Human skin tissue at an antibody concentration of 4-8 ug/mL.")
![Immunohistochemistry: Decorin Antibody [NBP1-57923] - Comparative immunohistochemical analysis of non-chondrodystrophic (NCD) & chondrodystrophic (CD) canine nucleus pulposus (NP) expression & distribution of decorin, biglycan, fibromodulin, hyaluronan & proteoglycan link protein 1 (HAPLN1), & aggrecan. For all extracellular matrix (ECM) proteins, the NCD canine intervertebral disc NP reveals a cobweb appearance, demonstrating intense staining for all proteins located in the areas tightly between the cells. Immunostaining with decorin reveals diffuse intercellular staining with negative immunostaining within the large, physaliferous-appearing notochordal cells. This presentation is in contrast to the abundant staining of these proteins in every CD NP sample. Decorin, biglycan, & HAPLN1 reveal intense staining within the ECM, with abundant clusters of small numbers of cells present within the NP. Although the ECM staining is less intense than that for the other three proteins, fibromodulin & aggrecan immunostaining is present. Furthermore, the CD NP stained for aggrecan reveals intense pericellular immunostaining diffusely throughout the ECM that is much less cellular than the NCD NP staining. Safranin-O staining shows quite intense ECM staining in the CD NP, whereas the NCD sample demonstrates intense intercellular staining without large, acellular ECM areas rich in proteoglycan staining. The overall appearance of the CD NP bears a strong resemblance to a fibrocartilaginous phenotype that is distinctly different from the NCD canine NP Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26341258), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-57923_rabbit-polyclonal-decorin-antibody-310202416182638.jpg "Immunohistochemistry: Decorin Antibody [NBP1-57923] - Comparative immunohistochemical analysis of non-chondrodystrophic (NCD) & chondrodystrophic (CD) canine nucleus pulposus (NP) expression & distribution of decorin, biglycan, fibromodulin, hyaluronan & proteoglycan link protein 1 (HAPLN1), & aggrecan. For all extracellular matrix (ECM) proteins, the NCD canine intervertebral disc NP reveals a cobweb appearance, demonstrating intense staining for all proteins located in the areas tightly between the cells. Immunostaining with decorin reveals diffuse intercellular staining with negative immunostaining within the large, physaliferous-appearing notochordal cells. This presentation is in contrast to the abundant staining of these proteins in every CD NP sample. Decorin, biglycan, & HAPLN1 reveal intense staining within the ECM, with abundant clusters of small numbers of cells present within the NP. Although the ECM staining is less intense than that for the other three proteins, fibromodulin & aggrecan immunostaining is present. Furthermore, the CD NP stained for aggrecan reveals intense pericellular immunostaining diffusely throughout the ECM that is much less cellular than the NCD NP staining. Safranin-O staining shows quite intense ECM staining in the CD NP, whereas the NCD sample demonstrates intense intercellular staining without large, acellular ECM areas rich in proteoglycan staining. The overall appearance of the CD NP bears a strong resemblance to a fibrocartilaginous phenotype that is distinctly different from the NCD canine NP Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26341258), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/Versican_AF3054_Immunocytochemistry_6488.jpg)
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/af3054_human-versican-affinity-purified-polyclonal-ab-immunocytochemistry-842022131824.jpg)
![Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images/af3054_human-versican-affinity-purified-polyclonal-ab-22820241723618.jpg)
![Western Blot Lumican Antibody [Unconjugated]](https://images.novusbio.com/images2/Lumican_AF2846_Western_Blot_17014.jpg)
![Immunohistochemistry Lumican Antibody [Unconjugated]](https://images.novusbio.com/images2/Lumican_AF2846_Immunohistochemistry_17809.jpg)
![Western Blot SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Western_Blot_20730.jpg)
![Immunohistochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunohistochemistry_10419.jpg)
![Immunocytochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunocytochemistry__Immunofluorescence_23321.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
