![Immunohistochemistry-Paraffin: DAK Antibody [NBP1-84142] - Staining in human duodenum and skeletal muscle tissues using anti-TKFC antibody. Corresponding TKFC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DAK-Antibody-Immunohistochemistry-Paraffin-NBP1-84142-img0011.jpg "Immunohistochemistry-Paraffin: DAK Antibody [NBP1-84142] - Staining in human duodenum and skeletal muscle tissues using anti-TKFC antibody. Corresponding TKFC RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SVPGSKPTFELSADEVELGLGIHGEAGVRRIKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGRGVKIARA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DAK |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DAK Antibody (NBP1-84142)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DAK |
![Immunohistochemistry-Paraffin: DAK Antibody [NBP1-84142] - Staining of human duodenum, kidney, liver and skeletal muscle using Anti-TKFC antibody NBP1-84142 (A) shows similar protein distribution across tissues to independent antibody NBP2-48894 (B).](http://images.novusbio.com/fullsize/DAK-Antibody-Immunohistochemistry-Paraffin-NBP1-84142-img0012.jpg "Immunohistochemistry-Paraffin: DAK Antibody [NBP1-84142] - Staining of human duodenum, kidney, liver and skeletal muscle using Anti-TKFC antibody NBP1-84142 (A) shows similar protein distribution across tissues to independent antibody NBP2-48894 (B).")
![Western Blot: DAK Antibody [NBP1-84142] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/DAK-Antibody-Western-Blot-NBP1-84142-img0006.jpg "Western Blot: DAK Antibody [NBP1-84142] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunocytochemistry/Immunofluorescence: DAK Antibody [NBP1-84142] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize/DAK-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84142-img0007.jpg "Immunocytochemistry/Immunofluorescence: DAK Antibody [NBP1-84142] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.")
![Immunohistochemistry-Paraffin: DAK Antibody [NBP1-84142] - Staining of human liver.](http://images.novusbio.com/fullsize/DAK-Antibody-Immunohistochemistry-Paraffin-NBP1-84142-img0015.jpg "Immunohistochemistry-Paraffin: DAK Antibody [NBP1-84142] - Staining of human liver.")
![Immunohistochemistry-Paraffin: DAK Antibody [NBP1-84142] - Staining of human duodenum shows high expression.](http://images.novusbio.com/fullsize/DAK-Antibody-Immunohistochemistry-Paraffin-NBP1-84142-img0009.jpg "Immunohistochemistry-Paraffin: DAK Antibody [NBP1-84142] - Staining of human duodenum shows high expression.")
![Immunohistochemistry-Paraffin: DAK Antibody [NBP1-84142] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/DAK-Antibody-Immunohistochemistry-Paraffin-NBP1-84142-img0010.jpg "Immunohistochemistry-Paraffin: DAK Antibody [NBP1-84142] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: DAK Antibody [NBP1-84142] - Staining of human kidney.](http://images.novusbio.com/fullsize/DAK-Antibody-Immunohistochemistry-Paraffin-NBP1-84142-img0013.jpg "Immunohistochemistry-Paraffin: DAK Antibody [NBP1-84142] - Staining of human kidney.")
![Western Blot Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Western_Blot_5296.jpg)
![Simple Western Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Simple_Western_16762.jpg)
![Immunocytochemistry Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Immunocytochemistry__Immunofluorescence_17421.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![SDS-PAGE FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF-8_423-F8_332.jpg)
![Bioactivity FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF8_423F8_1438.jpg)
![Cell Culture FGF-8 [Unconjugated]](https://images.novusbio.com/images/423-f8_recombinant-human-mouse-fgf-8b-protein-cell-culture-1052024145159..jpg)
![SDS-PAGE FGF-10 [Unconjugated]](https://images.novusbio.com/images2/FGF-10_345-FG_557.jpg)
![Bioactivity FGF-10 [Unconjugated]](https://images.novusbio.com/images2/FGF-10_345-FG_559.jpg)
![Bioactivity FGF-10 [Unconjugated]](https://images.novusbio.com/images/345-fg_recombinant-human-fgf-10-protein-bioactivity-2520239220..jpg)
![SDS-PAGE FGF-4 [Unconjugated]](https://images.novusbio.com/images2/FGF-4_235-F4_472.jpg)
![Bioactivity FGF-4 [Unconjugated]](https://images.novusbio.com/images2/FGF-4_235-F4_483.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")