![Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining in human bone marrow and skeletal muscle tissues using anti-TKT antibody. Corresponding TKT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Transketolase-Antibody-Immunohistochemistry-Paraffin-NBP1-87441-img0015.jpg "Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining in human bone marrow and skeletal muscle tissues using anti-TKT antibody. Corresponding TKT RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TKT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Transketolase antibody validated for WB from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
WB | Other | 09/03/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Transketolase Antibody (NBP1-87441)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TKT |
![Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow, cerebral cortex, skeletal muscle and testis using Anti-TKT antibody NBP1-87441 (A) shows similar protein distribution across tissues to independent antibody NBP1-87442 (B).](http://images.novusbio.com/fullsize/Transketolase-Antibody-Immunohistochemistry-Paraffin-NBP1-87441-img0028.jpg "Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow, cerebral cortex, skeletal muscle and testis using Anti-TKT antibody NBP1-87441 (A) shows similar protein distribution across tissues to independent antibody NBP1-87442 (B).")
![Western Blot: Transketolase Antibody [NBP1-87441] - Western blot analysis in human cell lines A-549 and U2OS. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.](http://images.novusbio.com/fullsize/Transketolase-Antibody-Western-Blot-NBP1-87441-img0018.jpg "Western Blot: Transketolase Antibody [NBP1-87441] - Western blot analysis in human cell lines A-549 and U2OS. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.")
![Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TKT antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Transketolase-Antibody-Western-Blot-NBP1-87441-img0022.jpg "Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TKT antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: Transketolase Antibody [NBP1-87441] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Transketolase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87441-img0016.jpg "Immunocytochemistry/Immunofluorescence: Transketolase Antibody [NBP1-87441] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/Transketolase-Antibody-Immunohistochemistry-Paraffin-NBP1-87441-img0033.jpg "Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle shows low expression as expected.")
![Western Blot: Transketolase Antibody [NBP1-87441] - Analysis of 293T cells lysate after siren treatment with siTWISTNB and siControl Transketolase. Image submitted by a verified customer review.](http://images.novusbio.com/fullsize/Transketolase-Antibody-Western-Blot-NBP1-87441-img0006.jpg "Western Blot: Transketolase Antibody [NBP1-87441] - Analysis of 293T cells lysate after siren treatment with siTWISTNB and siControl Transketolase. Image submitted by a verified customer review.")
![Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Transketolase-Antibody-Western-Blot-NBP1-87441-img0021.jpg "Western Blot: Transketolase Antibody [NBP1-87441] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human cerebral cortex using Anti-TKT antibody.](http://images.novusbio.com/fullsize/Transketolase-Antibody-Immunohistochemistry-Paraffin-NBP1-87441-img0026.jpg "Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human cerebral cortex using Anti-TKT antibody.")
![Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human testis using Anti-TKT antibody.](http://images.novusbio.com/fullsize/Transketolase-Antibody-Immunohistochemistry-Paraffin-NBP1-87441-img0027.jpg "Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human testis using Anti-TKT antibody.")
![Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow using Anti-TKT antibody NBP1-87441.](http://images.novusbio.com/fullsize/Transketolase-Antibody-Immunohistochemistry-Paraffin-NBP1-87441-img0030.jpg "Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow using Anti-TKT antibody NBP1-87441.")
![Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle using Anti-TKT antibody NBP1-87441.](http://images.novusbio.com/fullsize/Transketolase-Antibody-Immunohistochemistry-Paraffin-NBP1-87441-img0031.jpg "Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human skeletal muscle using Anti-TKT antibody NBP1-87441.")
![Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow shows high expression.](http://images.novusbio.com/fullsize/Transketolase-Antibody-Immunohistochemistry-Paraffin-NBP1-87441-img0032.jpg "Immunohistochemistry-Paraffin: Transketolase Antibody [NBP1-87441] - Staining of human bone marrow shows high expression.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")