Which is your best CXCR4 for immunohistochemistry in paraffin tissues? I would like to detect it in paraffin embedded tissues from human breast cancer samples.

Name: Recombinant Human CXCR4 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00007852-Q01
Price: 569 USD

Question

Accepted Answer

CXCR4 antibody (NB100-74396) is our best selling product among all the CXCR4 antibodies and it has been validated for IHC-P in human cervical carcinoma tissue sections. NB100-74396 has been cited in at least 7 research publications. Additionally, here is a list of all of our CXCR4 antibodies that has been verified in IHC-P in human samples.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-46 of Human CXCR4 Source: Wheat Germ (in vitro) Amino Acid Sequence: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	CXCR4
Purity	>80% by SDS-PAGE and Coomassie blue staining

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	30.8 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Recombinant Human CXCR4 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human CXCR4 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human CXCR4 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CXCR4 Partial Recombinant Protein (H00007852-Q01) (0)

Reviews for CXCR4 Partial Recombinant Protein (H00007852-Q01) (0)

Product General Protocols

Video Protocols

FAQs for CXCR4 Partial Recombinant Protein (H00007852-Q01). (Showing 1 - 1 of 1 FAQ).

Additional CXCR4 Products

Research Areas for CXCR4 Partial Recombinant Protein (H00007852-Q01)

Blogs on CXCR4.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics