Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen | CXCL6 (NP_002984.1, 1 a.a. - 114 a.a.) full-length human protein. MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
Specificity | CXCL6 - chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2), |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CXCL6 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Publication using H00006372-D01P | Applications | Species |
---|---|---|
Vaithilingam V, Quayum N, Joglekar MV et al. Effect of alginate encapsulation on the cellular transcriptome of human islets. Biomaterials. 2011-09-01 [PMID: 21889795] |
Secondary Antibodies |
Isotype Controls |
Research Areas for CXCL6/GCP-2 Antibody (H00006372-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CXCL6 |
Entrez |
|
Uniprot |
|