![Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane, Gel Concentration: 0.12%](http://images.novusbio.com/fullsize/CRY1-Antibody-Western-Blot-NBP1-69080-img0007.jpg "Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane, Gel Concentration: 0.12%")
| Reactivity | Hu, AmSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to CRY1 (cryptochrome 1, photolyase-like). The peptide sequence was selected from the N terminal of CRY1 (NP_004066). Peptide sequence KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CRY1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | In Simple Western internal validation: HeLa lysate at 0.5 mg/ml as sample; separated by size; antibody dilution of 1:50; observed molecular weight was 61 kDa;matrix was 12-230 kDa; detected by Chemiluminescence. |
||
| Theoretical MW | 64 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Publication using NBP1-69080 | Applications | Species |
|---|---|---|
| Lee YY, Cal-Kayitmazbatir S, Francey LJ et al. duper is a null mutation of Cryptochrome 1 in Syrian hamsters Proceedings of the National Academy of Sciences of the United States of America 2022-05-03 [PMID: 35471909] (IHC-Fr, WB, Syrian Hamster) | IHC-Fr, WB | Syrian Hamster |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Deborah Lutterschmidt |
IHC-Fr | Hyla cinerea | 10/23/2023 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for CRY1 Antibody (NBP1-69080)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Deborah Lutterschmidt 10/23/2023 |
||
| Application: | IHC-Fr | |
| Species: | Hyla cinerea |
![Immunohistochemistry-Paraffin: CRY1 Antibody [NBP1-69080] - Human testis tissue at an antibody concentration of 5ug/ml.](http://images.novusbio.com/fullsize/CRY1-Antibody-Immunohistochemistry-Paraffin-NBP1-69080-img0003.jpg "Immunohistochemistry-Paraffin: CRY1 Antibody [NBP1-69080] - Human testis tissue at an antibody concentration of 5ug/ml.")
![Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue:Hela Whole cell. Lane A: Primary Antibody Lane B: Primary Antibody + Blocking.](http://images.novusbio.com/fullsize/CRY1-Antibody-Western-Blot-NBP1-69080-img0004.jpg "Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue:Hela Whole cell. Lane A: Primary Antibody Lane B: Primary Antibody + Blocking.")
![Immunohistochemistry-Frozen: Rabbit Polyclonal CRY1 Antibody [NBP1-69080] - DAB staining in SCN of green treefrog, 10X. Primary antibody dilution - 1:1000. Image from a verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp1-69080_rabbit-polyclonal-cry1-antibody-immunohistochemistry-frozen-7112023151717..png "Immunohistochemistry-Frozen: Rabbit Polyclonal CRY1 Antibody [NBP1-69080] - DAB staining in SCN of green treefrog, 10X. Primary antibody dilution - 1:1000. Image from a verified customer review.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
