![Western Blot: CRHBP Antibody [NBP1-91811] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/CRHBP-Antibody-Western-Blot-NBP1-91811-img0004.jpg "Western Blot: CRHBP Antibody [NBP1-91811] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CRHBP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Bioactivity C1QL1 [Unconjugated]](https://images.novusbio.com/images2/C1qL1_9134TN_1238.jpg)
![Western Blot Carbonic Anhydrase VIII/CA8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_VIII_AF2187_Western_Blot_20462.jpg)
![Simple Western Carbonic Anhydrase VIII/CA8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_VIII_AF2187_Simple_Western_20463.jpg)
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CRHBP Antibody (NBP1-91811)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CRHBP |
![Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811] - Staining of human testis shows strong positivity in secretion.](http://images.novusbio.com/fullsize/CRHBP-Antibody-Immunohistochemistry-Paraffin-NBP1-91811-img0007.jpg "Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811] - Staining of human testis shows strong positivity in secretion.")
![Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811] - Staining of human placenta shows distinct extracellular positivity.](http://images.novusbio.com/fullsize/CRHBP-Antibody-Immunohistochemistry-Paraffin-NBP1-91811-img0002.jpg "Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811] - Staining of human placenta shows distinct extracellular positivity.")
![Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811] - Staining of human kidney shows moderate to strong positivity in secretion.](http://images.novusbio.com/fullsize/CRHBP-Antibody-Immunohistochemistry-Paraffin-NBP1-91811-img0005.jpg "Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811] - Staining of human kidney shows moderate to strong positivity in secretion.")
![Immunohistochemistry: CRHBP Antibody [NBP1-91811] - Staining of human small intestine shows strong positivity in secretion.](http://images.novusbio.com/fullsize/CRHBP-Antibody-Immunohistochemistry-NBP1-91811-img0006.jpg "Immunohistochemistry: CRHBP Antibody [NBP1-91811] - Staining of human small intestine shows strong positivity in secretion.")
![Enzyme Activity Heparanase/HPSE [Unconjugated]](https://images.novusbio.com/images2/7570-gh_recombinant-human-active-heparanase-hpse-protein-cf-enzyme-activity-202202316147.jpg)
![SDS-PAGE Heparanase/HPSE [Unconjugated]](https://images.novusbio.com/images2/7570-gh_recombinant-human-active-heparanase-hpse-protein-cf-sds-page-2022023162028.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")