Home » CREM » CREM Proteins » CREM Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CREM Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CREM Protein (NBP1-81760PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CREM Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CREM.

Source: E. coli

Amino Acid Sequence: QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CREM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81760.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CREM Recombinant Protein Antigen

  • cAMP response element modulator
  • cAMP responsive element modulator
  • cAMP-responsive element modulator
  • hCREM 2alpha-b protein
  • hCREM 2beta-a protein
  • hCREM-2
  • ICER
  • inducible cAMP early repressor ICER
  • Inducible cAMP early repressor
  • MGC111110
  • MGC17881
  • MGC41893

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CREB [p Ser133]
[Biotin]
DYC2510-2
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(19 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(370 Publications)
Species: Hu
Applications: BA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
CBP/KAT3A Antibody
(257003) [Unconjugate ...
MAB2676
Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]
Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
NHS Antibody (6D9)
H00004810-M05
ELISA NHS Antibody (6D9)
Immunocytochemistry/ Immunofluorescence NHS Antibody (6D9)
Species: Hu
Applications: ELISA, ICC/IF, WB
GDNF [Unconjugated]
212-GD
Bioactivity GDNF [Unconjugated]
SDS-PAGE GDNF [Unconjugated]
SEC-MALS GDNF [Unconjugated]
(209 Publications)
Species: Hu
Applications: Bind, BA
ATF1 Antibody
NBP2-38747
Immunocytochemistry/ Immunofluorescence ATF1 Antibody
Immunohistochemistry-Paraffin ATF1 Antibody
Immunohistochemistry-Paraffin ATF1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
FHL5 Antibody
NBP1-32660
Immunocytochemistry/ Immunofluorescence FHL5 Antibody
Immunohistochemistry-Paraffin FHL5 Antibody
Western Blot FHL5 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western PAG1 Antibody (504004) [Unconjugated]
Western Blot PAG1 Antibody (504004) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin BRD2 Antibody
Immunocytochemistry/ Immunofluorescence BRD2 Antibody
Immunoprecipitation BRD2 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MCG10 Antibody -
BSA Free
NBP1-76729
Immunocytochemistry/ Immunofluorescence MCG10 Antibody - BSA Free
Western Blot MCG10 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence MCG10 Antibody - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
Opsin 1 (Long
Wave) Antibody
NBP3-09392
Western Blot Opsin 1 (Long Wave) Antibody
Species: Hu, Mu
Applications: WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot eIF4E [p Ser209] Antibody
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
CREM Recombinant
Protein Antigen
NBP1-81760PEP
CREM Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CREM Protein (NBP1-81760PEP) (0)

There are no publications for CREM Protein (NBP1-81760PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREM Protein (NBP1-81760PEP) (0)

There are no reviews for CREM Protein (NBP1-81760PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CREM Protein (NBP1-81760PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CREM Products

Research Areas for CREM Protein (NBP1-81760PEP)

Find related products by research area.

Blogs on CREM

There are no specific blogs for CREM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunocytochemistry/Immunofluorescence: CREM Antibody (3B5) [H00001390-M02] - UTGB1, primary glioblastoma cell line, expressing the EWSR1-CREM fusion, stained using CREM antibody at 1:200. Secondary Antibody: Alexa Fluor 568 conjugate. Image from verified customer review.
CREM Antibody (3B5)
H00001390-M02
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CREM Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CREM