![Western Blot: CREM Antibody (3B5) [H00001390-M02] - CREM monoclonal antibody (M02), clone 3B5. Analysis of CREM expression in human liver.](http://images.novusbio.com/fullsize/CREM-Antibody-3B5-Western-Blot-H00001390-M02-img0004.jpg "Western Blot: CREM Antibody (3B5) [H00001390-M02] - CREM monoclonal antibody (M02), clone 3B5. Analysis of CREM expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, KD |
| Clone | 3B5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | CREM (NP_853549, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY |
| Specificity | CREM (3B5) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CREM |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00001390-M02 | Applications | Species |
|---|---|---|
| David K, Isis P Dual regulation of miR-375 and CREM genes in pancreatic beta cells. Islets. 2022-04-04 [PMID: 35377267] |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Vanina D. Heuser |
ICC | Human | 08/30/2018 |
Summary
|
||||||||
Enlarge |
reviewed by:
Vanina D. Heuser |
WB | Human | 08/30/2018 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for CREM Antibody (H00001390-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Vanina D. Heuser 08/30/2018 |
||
| Application: | ICC | |
| Species: | Human |
| Vanina D. Heuser 08/30/2018 |
||
| Application: | WB | |
| Species: | Human |
![Immunocytochemistry/Immunofluorescence: CREM Antibody (3B5) [H00001390-M02] - UTGB1, primary glioblastoma cell line, expressing the EWSR1-CREM fusion, stained using CREM antibody at 1:200. Secondary Antibody: Alexa Fluor 568 conjugate. Image from verified customer review.](http://images.novusbio.com/fullsize/CREM-Antibody-3B5-Immunocytochemistry-Immunofluorescence-H00001390-M02-img0006.jpg "Immunocytochemistry/Immunofluorescence: CREM Antibody (3B5) [H00001390-M02] - UTGB1, primary glioblastoma cell line, expressing the EWSR1-CREM fusion, stained using CREM antibody at 1:200. Secondary Antibody: Alexa Fluor 568 conjugate. Image from verified customer review.")
![Immunocytochemistry/Immunofluorescence: CREM Antibody (3B5) [H00001390-M02] - Analysis of monoclonal antibody to CREM on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/CREM-Antibody-3B5-Immunocytochemistry-Immunofluorescence-H00001390-M02-img0002.jpg "Immunocytochemistry/Immunofluorescence: CREM Antibody (3B5) [H00001390-M02] - Analysis of monoclonal antibody to CREM on HeLa cell . Antibody concentration 10 ug/ml.")
![Sandwich ELISA: CREM Antibody (3B5) [H00001390-M02] - Detection limit for recombinant GST tagged CREM is 0.03 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/CREM-Antibody-3B5-Sandwich-ELISA-H00001390-M02-img0003.jpg "Sandwich ELISA: CREM Antibody (3B5) [H00001390-M02] - Detection limit for recombinant GST tagged CREM is 0.03 ng/ml as a capture antibody.")
![Knockdown Validated: CREM Antibody (3B5) [H00001390-M02] - UTGB1, primary glioblastoma cell line, expressing the EWSR1-CREM fusion, treated with non-target siRNA and different concentrations of CREM siRNA. Image from verified customer review.](http://images.novusbio.com/fullsize/CREM-Antibody-3B5-Knockdown-Validated-H00001390-M02-img0005.jpg "Knockdown Validated: CREM Antibody (3B5) [H00001390-M02] - UTGB1, primary glioblastoma cell line, expressing the EWSR1-CREM fusion, treated with non-target siRNA and different concentrations of CREM siRNA. Image from verified customer review.")
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221341.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221447.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221551.png)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Bioactivity GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212GD_2846.jpg)
![SDS-PAGE GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212-GD_62.jpg)
![SEC-MALS GDNF [Unconjugated]](https://images.novusbio.com/images/212-gd_recombinant-human-gdnf-protein-sec-mals-25202393740..jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")
