![Western Blot: CRABP1 Antibody (7N4F3) [NBP3-16601] - Analysis of extracts of various cell lines, using CRABP1 Rabbit mAb (NBP3-16601) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/CRABP1-Antibody-7N4F3-Western-Blot-NBP3-16601-img0006.jpg "Western Blot: CRABP1 Antibody (7N4F3) [NBP3-16601] - Analysis of extracts of various cell lines, using CRABP1 Rabbit mAb (NBP3-16601) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 7N4F3 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 58-137 of human CRABP1 (P29762). TVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CRABP1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 16 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CRABP1 Antibody (NBP3-16601)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CRABP1 |
![Immunohistochemistry: CRABP1 Antibody (7N4F3) [NBP3-16601] - Immunofluorescence analysis of rat eye using CRABP1 Rabbit mAb (NBP3-16601) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CRABP1-Antibody-7N4F3-Immunohistochemistry-NBP3-16601-img0005.jpg "Immunohistochemistry: CRABP1 Antibody (7N4F3) [NBP3-16601] - Immunofluorescence analysis of rat eye using CRABP1 Rabbit mAb (NBP3-16601) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot: CRABP1 Antibody (7N4F3) [NBP3-16601] - Analysis of extracts of Mouse testis, using CRABP1 Rabbit mAb (NBP3-16601) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/CRABP1-Antibody-7N4F3-Western-Blot-NBP3-16601-img0007.jpg "Western Blot: CRABP1 Antibody (7N4F3) [NBP3-16601] - Analysis of extracts of Mouse testis, using CRABP1 Rabbit mAb (NBP3-16601) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![N/A RBP4/Retinol-Binding Protein 4 [HRP]](https://images.novusbio.com/images2/RBP4_DRB400_ELISA_169.jpg)
![N/A RBP4/Retinol-Binding Protein 4 [HRP]](https://images.novusbio.com/images2/DATA_RBP4_DRB400_ELISA_804.jpg)
![Immunocytochemistry RUNX3/CBFA3 Antibody (527327) [Unconjugated]](https://images.novusbio.com/images2/RUNX3_MAB3765_Immunocytochemistry_10636.jpg)
![Western Blot RUNX3/CBFA3 Antibody (527327) [Unconjugated]](https://images.novusbio.com/images2/RUNX3_MAB3765_Western_Blot_10662.jpg)
![Simple Western RUNX3/CBFA3 Antibody (527327) [Unconjugated]](https://images.novusbio.com/images2/16364.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")