![Western Blot: RBP2 Antibody [NBP1-85464] - Analysis in control (vector only transfected HEK293T lysate) and RBP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/RBP2-Antibody-Western-Blot-NBP1-85464-img0009.jpg "Western Blot: RBP2 Antibody [NBP1-85464] - Analysis in control (vector only transfected HEK293T lysate) and RBP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RBP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RBP2 Antibody (NBP1-85464)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RBP2 |
![Immunocytochemistry/Immunofluorescence: RBP2 Antibody [NBP1-85464] - Immunofluorescent staining of human cell line CACO-2 shows localization to the Golgi apparatus.](http://images.novusbio.com/fullsize/RBP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85464-img0005.jpg "Immunocytochemistry/Immunofluorescence: RBP2 Antibody [NBP1-85464] - Immunofluorescent staining of human cell line CACO-2 shows localization to the Golgi apparatus.")
![Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining in human duodenum and liver tissues using anti-RBP2 antibody. Corresponding RBP2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RBP2-Antibody-Immunohistochemistry-Paraffin-NBP1-85464-img0008.jpg "Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining in human duodenum and liver tissues using anti-RBP2 antibody. Corresponding RBP2 RNA-seq data are presented for the same tissues.")
![Western Blot: RBP2 Antibody [NBP1-85464] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/RBP2-Antibody-Western-Blot-NBP1-85464-img0004.jpg "Western Blot: RBP2 Antibody [NBP1-85464] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining of human duodenum shows high expression.](http://images.novusbio.com/fullsize/RBP2-Antibody-Immunohistochemistry-Paraffin-NBP1-85464-img0006.jpg "Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining of human duodenum shows high expression.")
![Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/RBP2-Antibody-Immunohistochemistry-Paraffin-NBP1-85464-img0007.jpg "Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry FABP7/B-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP7_AF3166_Immunohistochemistry_6776.jpg)
![Simple Western FABP7/B-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP7_AF3166_Simple_Western_18665.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")