CNOT6 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYN |
Predicted Species |
Mouse (98%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CNOT6 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for CNOT6 Antibody
Background
CNOT6 is encoded by this gene is a subunit of the CCR4-NOT core transcriptional regulation complex. The encoded protein has a 3'-5' RNase activity and prefers polyadenylated substates. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, Neut
Publications for CNOT6 Antibody (NBP1-86564) (0)
There are no publications for CNOT6 Antibody (NBP1-86564).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CNOT6 Antibody (NBP1-86564) (0)
There are no reviews for CNOT6 Antibody (NBP1-86564).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CNOT6 Antibody (NBP1-86564) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CNOT6 Products
Blogs on CNOT6