![Western Blot: Claudin-15 Antibody [H00024146-D01P] - Analysis of CLDN15 expression in human kidney.](http://images.novusbio.com/fullsize/Claudin-15-Antibody-Western-Blot-H00024146-D01P-img0001.jpg "Western Blot: Claudin-15 Antibody [H00024146-D01P] - Analysis of CLDN15 expression in human kidney.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | CLDN15 (NP_055158.1, 1 a.a. - 228 a.a.) full-length human protein. MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATAGALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CLDN15 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Claudin-15 antibody validated for Flow cytometry from a verified customer review. |
|
| Reviewed Applications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
Flow | Human | 10/01/2019 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CLDN15 |
| Uniprot |
|
![Flow Cytometry: Claudin-15 Antibody [H00024146-D01P] - Flow cytometry image submitted by a verified customer review.](http://images.novusbio.com/fullsize/Claudin-15-Antibody-Flow-Cytometry-H00024146-D01P-img0003.jpg "Flow Cytometry: Claudin-15 Antibody [H00024146-D01P] - Flow cytometry image submitted by a verified customer review.")
![Western Blot: Claudin-15 Antibody [H00024146-D01P] - Analysis of CLDN15 expression in transfected 293T cell line by CLDN15 polyclonal antibody.Lane 1: CLDN15 transfected lysate(24.40 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Claudin-15-Antibody-Western-Blot-H00024146-D01P-img0002.jpg "Western Blot: Claudin-15 Antibody [H00024146-D01P] - Analysis of CLDN15 expression in transfected 293T cell line by CLDN15 polyclonal antibody.Lane 1: CLDN15 transfected lysate(24.40 KDa).Lane 2: Non-transfected lysate.")
![Flow Cytometry Claudin-4 Antibody (382321) [Unconjugated]](https://images.novusbio.com/images2/Claudin4_MAB4219_Flow_Cytometry_21352.jpg)
![Immunocytochemistry Claudin-6 Antibody (342927) [Unconjugated]](https://images.novusbio.com/images2/Claudin6_MAB3656_Immunocytochemistry_15896.jpg)
![Flow Cytometry Claudin-6 Antibody (342927) [Unconjugated]](https://images.novusbio.com/images2/Claudin6_MAB3656_Flow_Cytometry_22547.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
