![Western Blot: Claudin-12 Antibody [NBP1-87450] - Increased CLDN-5 and decreased CLDN-12 expression in the cortex of ASD subjects. a Brain tissues were lysed and immunoblotted with anti-claudin-12, SMA or actin antibody. b Densitometry analysis of the results from the western blots is shown, where the data are normalized against SMA expression and are expressed as the mean +/- standard error. Quantitative results represent the average of three independent experiments. ****p < 0.0001. Image collected and cropped by CiteAb from the following publication (//molecularautism.biomedcentral.com/articles/10.1186/s13229-016-0110-z) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Claudin-12-Antibody-Western-Blot-NBP1-87450-img0008.jpg "Western Blot: Claudin-12 Antibody [NBP1-87450] - Increased CLDN-5 and decreased CLDN-12 expression in the cortex of ASD subjects. a Brain tissues were lysed and immunoblotted with anti-claudin-12, SMA or actin antibody. b Densitometry analysis of the results from the western blots is shown, where the data are normalized against SMA expression and are expressed as the mean +/- standard error. Quantitative results represent the average of three independent experiments. ****p < 0.0001. Image collected and cropped by CiteAb from the following publication (//molecularautism.biomedcentral.com/articles/10.1186/s13229-016-0110-z) licensed under a CC-BY license.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT |
| Predicted Species | Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CLDN12 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 29986305). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CLDN12 |
![Immunohistochemistry-Paraffin: Claudin-12 Antibody [NBP1-87450] - Staining of human pancreas shows moderate cytoplasmic and membranous positivity in exocrine glandular cells along with moderate cytoplasmic staining in islets of Langerhans](http://images.novusbio.com/fullsize/Claudin-12-Antibody-Immunohistochemistry-Paraffin-NBP1-87450-img0006.jpg "Immunohistochemistry-Paraffin: Claudin-12 Antibody [NBP1-87450] - Staining of human pancreas shows moderate cytoplasmic and membranous positivity in exocrine glandular cells along with moderate cytoplasmic staining in islets of Langerhans")
![Western Blot: Claudin-12 Antibody [NBP1-87450] - Analysis in human liver tissue.](http://images.novusbio.com/fullsize/Claudin-12-Antibody-Western-Blot-NBP1-87450-img0007.jpg "Western Blot: Claudin-12 Antibody [NBP1-87450] - Analysis in human liver tissue.")
![Western Blot: Claudin-12 Antibody [NBP1-87450] - Increased CLDN-5 expression in the cerebellum of ASD subjects. a Western blots of brain lysates immunoblotted with anti-claudin-5, anti-claudin-12, SMA or actin antibody. b Densitometry analysis of the results from the western blots is shown, where the data are normalized against SMA expression & are expressed as the mean ± standard error. Quantitative results represent the average of three independent experiments. ***p < 0.001 Image collected & cropped by CiteAb from the following publication (//molecularautism.biomedcentral.com/articles/10.1186/s13229-016-0110-z), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-87450_rabbit-polyclonal-claudin-12-antibody-310202415394517.jpg "Western Blot: Claudin-12 Antibody [NBP1-87450] - Increased CLDN-5 expression in the cerebellum of ASD subjects. a Western blots of brain lysates immunoblotted with anti-claudin-5, anti-claudin-12, SMA or actin antibody. b Densitometry analysis of the results from the western blots is shown, where the data are normalized against SMA expression & are expressed as the mean ± standard error. Quantitative results represent the average of three independent experiments. ***p < 0.001 Image collected & cropped by CiteAb from the following publication (//molecularautism.biomedcentral.com/articles/10.1186/s13229-016-0110-z), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Claudin-12 Antibody [NBP1-87450] - Increased CLDN-5 & decreased CLDN-12 expression in the cortex of ASD subjects. a Brain tissues were lysed & immunoblotted with anti-claudin-5, anti-claudin-12, SMA or actin antibody. b Densitometry analysis of the results from the western blots is shown, where the data are normalized against SMA expression & are expressed as the mean ± standard error. Quantitative results represent the average of three independent experiments.*p < 0.05; ****p < 0.0001 Image collected & cropped by CiteAb from the following publication (//molecularautism.biomedcentral.com/articles/10.1186/s13229-016-0110-z), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-87450_rabbit-polyclonal-claudin-12-antibody-310202415291991.jpg "Western Blot: Claudin-12 Antibody [NBP1-87450] - Increased CLDN-5 & decreased CLDN-12 expression in the cortex of ASD subjects. a Brain tissues were lysed & immunoblotted with anti-claudin-5, anti-claudin-12, SMA or actin antibody. b Densitometry analysis of the results from the western blots is shown, where the data are normalized against SMA expression & are expressed as the mean ± standard error. Quantitative results represent the average of three independent experiments.*p < 0.05; ****p < 0.0001 Image collected & cropped by CiteAb from the following publication (//molecularautism.biomedcentral.com/articles/10.1186/s13229-016-0110-z), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Claudin-6 Antibody (342927) [Unconjugated]](https://images.novusbio.com/images2/Claudin6_MAB3656_Immunocytochemistry_15896.jpg)
![Flow Cytometry Claudin-6 Antibody (342927) [Unconjugated]](https://images.novusbio.com/images2/Claudin6_MAB3656_Flow_Cytometry_22547.jpg)
![Flow Cytometry Claudin-4 Antibody (382321) [Unconjugated]](https://images.novusbio.com/images2/Claudin4_MAB4219_Flow_Cytometry_21352.jpg)
![Knockout Validated Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images2/Calcitonin_R_MAB4614_Knockout_Validated_23018.jpg)
![Flow Cytometry Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images2/Calcitonin_R_MAB4614_Flow_Cytometry_8474.jpg)
![Immunocytochemistry/ Immunofluorescence Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images/mab4614_human-calcitonin-r-mab-clone-462802-41202410484315.jpg)
![Western Blot Calbindin D/S100G Antibody [Unconjugated]](https://images.novusbio.com/images2/Calbindin_D_AF3320_Western_Blot_17076.jpg)
![Simple Western Calbindin D/S100G Antibody [Unconjugated]](https://images.novusbio.com/images2/Calbindin_D_AF3320_Immunohistochemistry_17486.jpg)
![Immunohistochemistry Calbindin D/S100G Antibody [Unconjugated]](https://images.novusbio.com/images2/af3320_human-calbindin-d-affinity-purified-polyclonal-ab-immunohistochemistry-1612202012853.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")