Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ELISA, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 171-216 of human CEBP Beta (NP_005185.2). Sequence: AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CEBPB |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Theoretical MW | 36 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.3), 50% glycerol |
Preservative | 0.09% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CEBP Beta Antibody (NBP3-35083)Find related products by research area.
|
Transcription Factor Antibodies Used In Landmark Evolutionary Study We at Novus Biologicals offer a full antibody database targeted to transcription factor research. Recently, CEBP antibodieswere used in a research study exploring the evolution of gene regulation in various vertebrates. The results revealed surprising... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CEBPB |