![Western Blot: CDCA5 Antibody (1Y1C9) [NBP3-16318] - Western blot analysis of extracts of HepG2 cells, using CDCA5 Rabbit mAb (NBP3-16318) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/CDCA5-Antibody-1Y1C9-Western-Blot-NBP3-16318-img0002.jpg "Western Blot: CDCA5 Antibody (1Y1C9) [NBP3-16318] - Western blot analysis of extracts of HepG2 cells, using CDCA5 Rabbit mAb (NBP3-16318) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clone | 1Y1C9 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 153-252 of human CDCA5 (Q96FF9). GSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CDCA5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CDCA5 Antibody (NBP3-16318)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDCA5 |
![Immunohistochemistry-Paraffin: CDCA5 Antibody (1Y1C9) [NBP3-16318] - Immunohistochemistry of paraffin-embedded human thyroid cancer using CDCA5 Rabbit mAb (NBP3-16318) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/CDCA5-Antibody-1Y1C9-Immunohistochemistry-Paraffin-NBP3-16318-img0001.jpg "Immunohistochemistry-Paraffin: CDCA5 Antibody (1Y1C9) [NBP3-16318] - Immunohistochemistry of paraffin-embedded human thyroid cancer using CDCA5 Rabbit mAb (NBP3-16318) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![IL-9 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IL-9 [Unconjugated]")
![N/A Lipocalin-2/NGAL [Biotin]](https://images.novusbio.com/images2/DATA_Lipocalin2_DY1857_ELISA_2306.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")