![Western Blot: CD5L Antibody [NBP2-39094] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma](http://images.novusbio.com/fullsize/CD5L-Antibody-Western-Blot-NBP2-39094-img0002.jpg "Western Blot: CD5L Antibody [NBP2-39094] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CD5L |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CD5L Antibody (NBP2-39094)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CD5L Antibody [NBP2-39094] - Staining of human cerebral cortex shows no cytoplasmic positivity in neurons as expected.](http://images.novusbio.com/fullsize/CD5L-Antibody-Immunohistochemistry-Paraffin-NBP2-39094-img0010.jpg "Immunohistochemistry-Paraffin: CD5L Antibody [NBP2-39094] - Staining of human cerebral cortex shows no cytoplasmic positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: CD5L Antibody [NBP2-39094] - Staining of human cerebral cortex, fallopian tube, liver and spleen using Anti-CD5L antibody NBP2-39094 (A) shows similar protein distribution across tissues to independent antibody NBP2-39061 (B).](http://images.novusbio.com/fullsize/CD5L-Antibody-Immunohistochemistry-Paraffin-NBP2-39094-img0006.jpg "Immunohistochemistry-Paraffin: CD5L Antibody [NBP2-39094] - Staining of human cerebral cortex, fallopian tube, liver and spleen using Anti-CD5L antibody NBP2-39094 (A) shows similar protein distribution across tissues to independent antibody NBP2-39061 (B).")
![Immunohistochemistry-Paraffin: CD5L Antibody [NBP2-39094] - Analysis in human spleen and cerebral cortex tissues. Corresponding CD5L RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CD5L-Antibody-Immunohistochemistry-Paraffin-NBP2-39094-img0007.jpg "Immunohistochemistry-Paraffin: CD5L Antibody [NBP2-39094] - Analysis in human spleen and cerebral cortex tissues. Corresponding CD5L RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CD5L Antibody [NBP2-39094] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.](http://images.novusbio.com/fullsize/CD5L-Antibody-Immunohistochemistry-Paraffin-NBP2-39094-img0008.jpg "Immunohistochemistry-Paraffin: CD5L Antibody [NBP2-39094] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.")
![Immunohistochemistry-Paraffin: CD5L Antibody [NBP2-39094] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.](http://images.novusbio.com/fullsize/CD5L-Antibody-Immunohistochemistry-Paraffin-NBP2-39094-img0009.jpg "Immunohistochemistry-Paraffin: CD5L Antibody [NBP2-39094] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.")
![Immunohistochemistry-Paraffin: CD5L Antibody [NBP2-39094] - Staining of human fallopian tube shows moderate positivity in plasma in blood vessels.](http://images.novusbio.com/fullsize/CD5L-Antibody-Immunohistochemistry-Paraffin-NBP2-39094-img0011.jpg "Immunohistochemistry-Paraffin: CD5L Antibody [NBP2-39094] - Staining of human fallopian tube shows moderate positivity in plasma in blood vessels.")
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/Haptoglobin_DHAPG0_ELISA_461.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/DATA_Haptoglobin_DHAPG0_ELISA_709.jpg)
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![N/A CD163 [HRP]](https://images.novusbio.com/images2/CD163_DC1630_ELISA_43.jpg)
![N/A CD163 [HRP]](https://images.novusbio.com/images2/DATA_CD163_DC1630_ELISA_598.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")