![Western Blot: CD3 gamma Antibody (7J2L5) [NBP3-16327] - Western blot analysis of extracts of various cell lines, using CD3 gamma Rabbit mAb (NBP3-16327) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 120s.](http://images.novusbio.com/fullsize/CD3-gamma-Antibody-7J2L5-Western-Blot-NBP3-16327-img0002.jpg "Western Blot: CD3 gamma Antibody (7J2L5) [NBP3-16327] - Western blot analysis of extracts of various cell lines, using CD3 gamma Rabbit mAb (NBP3-16327) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 120s.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, Flow, ICC/IF |
| Clone | 7J2L5 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 83-182 of human CD3 gamma (P09693). GMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CD3G |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets-1_AF7284_Western_Blot_11854.jpg)
![Immunohistochemistry Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets1_AF7284_Immunohistochemistry_22698.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CD3 gamma Antibody (NBP3-16327)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CD3G |
![Immunocytochemistry/Immunofluorescence: CD3 gamma Antibody (7J2L5) [NBP3-16327] - Immunofluorescence analysis of Jurkat cells using CD3 gamma Rabbit mAb (NBP3-16327) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CD3-gamma-Antibody-7J2L5-Immunocytochemistry-Immunofluorescence-NBP3-16327-img0001.jpg "Immunocytochemistry/Immunofluorescence: CD3 gamma Antibody (7J2L5) [NBP3-16327] - Immunofluorescence analysis of Jurkat cells using CD3 gamma Rabbit mAb (NBP3-16327) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Flow Cytometry: CD3 gamma Antibody (7J2L5) [NBP3-16327] - Flow cytometry: Jurkat cells were stained with Rabbit IgG isotype control (AC042, 10 ug/ml, blue line) or CD3 gamma Rabbit mAb (NBP3-16327, 2.5 ug/ml orange line), followed by goat anti-Rabbit pAb FITC (1:200 dilution) staining. Non-fluorescently stained Jurkat cells was used as blank control (red line) .](http://images.novusbio.com/fullsize/CD3-gamma-Antibody-7J2L5-Flow-Cytometry-NBP3-16327-img0003.jpg "Flow Cytometry: CD3 gamma Antibody (7J2L5) [NBP3-16327] - Flow cytometry: Jurkat cells were stained with Rabbit IgG isotype control (AC042, 10 ug/ml, blue line) or CD3 gamma Rabbit mAb (NBP3-16327, 2.5 ug/ml orange line), followed by goat anti-Rabbit pAb FITC (1:200 dilution) staining. Non-fluorescently stained Jurkat cells was used as blank control (red line) .")
![Flow Cytometry: CD3 gamma Antibody (7J2L5) [NBP3-16327] - Flow cytometry: Raji cells were stained with Rabbit IgG isotype control (AC042, 10 ug/ml, blue line) or CD3 gamma Rabbit mAb (NBP3-16327, 2.5 ug/ml orange line), followed by goat anti-Rabbit pAb FITC (1:200 dilution) staining. Non-fluorescently stained Raji cells was used as blank control (red line) .](http://images.novusbio.com/fullsize/CD3-gamma-Antibody-7J2L5-Flow-Cytometry-NBP3-16327-img0004.jpg "Flow Cytometry: CD3 gamma Antibody (7J2L5) [NBP3-16327] - Flow cytometry: Raji cells were stained with Rabbit IgG isotype control (AC042, 10 ug/ml, blue line) or CD3 gamma Rabbit mAb (NBP3-16327, 2.5 ug/ml orange line), followed by goat anti-Rabbit pAb FITC (1:200 dilution) staining. Non-fluorescently stained Raji cells was used as blank control (red line) .")
![Flow Cytometry TCR gamma/delta Antibody (GL-3) [Unconjugated]](https://images.novusbio.com/images2/TCR_gamma_delta_MAB7297_Flow_Cytometry_11892.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")