Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CD28 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD28 Antibody (NBP2-57015)Find related products by research area.
|
Thomson Reuters Predicts 2016 Nobel Prize Winners Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro... Read full blog post. |
CD80: A co-stimulator of T cell activation CD80 is a 60kD single chain type I transmembrane glycoprotein that is a member of the immunoglobulin family. CD80 is expressed on activated B- and T-lymphocytes, as well as a subpopulation of previously activated B-cells, but not on the majority of re... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CD28 |