![Immunohistochemistry-Paraffin: CD11c Antibody [NBP1-91210] - Analysis in human spleen and skeletal muscle tissues using NBP1-91210 antibody. Corresponding ITGAX RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CD11c-Antibody-Immunohistochemistry-Paraffin-NBP1-91210-img0007.jpg "Immunohistochemistry-Paraffin: CD11c Antibody [NBP1-91210] - Analysis in human spleen and skeletal muscle tissues using NBP1-91210 antibody. Corresponding ITGAX RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRV |
| Marker | Dendritic Cell Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ITGAX |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Flow_Cytometry_16025.jpg)
![Immunohistochemistry B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Immunohistochemistry_17363.jpg)
![Dual RNAscope ISH-IHC Compatible B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Dual_RNAscope_ISHIHC_23827.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CD11c Antibody (NBP1-91210)Find related products by research area.
|
|
Read full blog post. |
|
CD11b: Marker for a New Type of B Cell that Participates in Cell-Mediated Immunity Think B lymphocytes just produce antibodies? Think again! Although, of course, B cells are vital for the humoral immune response, many studies in recent years have begun to uncover antibody-independent actions of B cells: regulating T cells and thus a... Read full blog post. |
|
Adhesion Receptor Molecule CD11b/c is the Point of Entry for many Infectious Diseases Pathogenic microorganisms utilize a variety of cell surface receptors to gain entry into host cells and to bypass the natural defense mechanisms. One of the most prominent receptors used in this fashion is the leukocyte adhesion receptor CD11b/c. This... Read full blog post. |
|
CD11b/CD18 and Neutrophil-Epithelial Interactions as Targets for Anti-Inflammatory Therapies The beta-2 integrins, a family of four cell surface transmembrane glycoproteins expressed only on leukocytes, include CD11a/CD18, CD11b/CD18, CD11c/CD18, and CD11d/CD18. They consist of a common beta subunit (CD18) and homologous alpha subunits (CD11a... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ITGAX |
![Immunohistochemistry-Paraffin: CD11c Antibody [NBP1-91210] - Staining of human testis shows strong membranous and cytoplasmic positivity in spermatids.](http://images.novusbio.com/fullsize/CD11c-Antibody-Immunohistochemistry-Paraffin-NBP1-91210-img0011.jpg "Immunohistochemistry-Paraffin: CD11c Antibody [NBP1-91210] - Staining of human testis shows strong membranous and cytoplasmic positivity in spermatids.")
![Immunohistochemistry-Paraffin: CD11c Antibody [NBP1-91210] - Staining of human lung shows weak membranous and cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/CD11c-Antibody-Immunohistochemistry-Paraffin-NBP1-91210-img0008.jpg "Immunohistochemistry-Paraffin: CD11c Antibody [NBP1-91210] - Staining of human lung shows weak membranous and cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: CD11c Antibody [NBP1-91210] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.](http://images.novusbio.com/fullsize/CD11c-Antibody-Immunohistochemistry-Paraffin-NBP1-91210-img0009.jpg "Immunohistochemistry-Paraffin: CD11c Antibody [NBP1-91210] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: CD11c Antibody [NBP1-91210] - Staining of human spleen shows strong membranous positivity in cells in white pulp.](http://images.novusbio.com/fullsize/CD11c-Antibody-Immunohistochemistry-Paraffin-NBP1-91210-img0010.jpg "Immunohistochemistry-Paraffin: CD11c Antibody [NBP1-91210] - Staining of human spleen shows strong membranous positivity in cells in white pulp.")
![Immunohistochemistry-Paraffin: CD11c Antibody [NBP1-91210] - Staining of human tonsil shows moderate membranous positivity in germinal center cells.](http://images.novusbio.com/fullsize/CD11c-Antibody-Immunohistochemistry-Paraffin-NBP1-91210-img0012.jpg "Immunohistochemistry-Paraffin: CD11c Antibody [NBP1-91210] - Staining of human tonsil shows moderate membranous positivity in germinal center cells.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_2_AF1730_Immunocytochemistry_6474.jpg)
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1730_human-integrin-beta-2-cd18-affinity-purified-polyclonal-ab-immunocytochemistry-1292023225343.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Integrin alpha L/CD11a Antibody (345913) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_L_MAB3595_Western_Blot_10266.jpg)
![Simple Western Integrin alpha L/CD11a Antibody (345913) [Unconjugated]](https://images.novusbio.com/images2/mab3595_human-integrin-alpha-l-cd11a-mab-clone-345913-simple-western-268202215744.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Immunohistochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD45_AF114_Immunohistochemistry_23525.jpg)
![Immunocytochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/af114_mouse-cd45-affinity-purified-polyclonal-ab-immunocytochemistry-6122021145449.jpg)
![Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]](https://images.novusbio.com/images/af114_mouse-cd45-affinity-purified-polyclonal-ab-41202410331954.jpg)
![Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Functional_Assay_15457.jpg)
![Western Blot CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Western_Blot_20204.jpg)
![Simple Western CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/af632_human-cd40-tnfrsf5-affinity-purified-polyclonal-ab-simple-western-58202111562.jpg)
![N/A CD14 [HRP]](https://images.novusbio.com/images2/CD14_DC140_ELISA_42.jpg)
![N/A CD14 [HRP]](https://images.novusbio.com/images2/DATA_CD14_DC140_ELISA_597.jpg)
![Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images2/ICAM1_AF796_Immunohistochemistry_17354.jpg)
![Western Blot ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images/af796_mouse-icam-1-cd54-affinity-purified-polyclonal-ab-4120241048112.jpg)
![Western Blot ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images/af796_mouse-icam-1-cd54-affinity-purified-polyclonal-ab-41202410481112.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")