Reactivity | HuSpecies Glossary |
Applications | ICC/IF |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | KIT |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD117/c-kit Antibody (NBP2-57890)Find related products by research area.
|
Do you see what I see? I c-Kit The c-Kit (CD117) proto-oncogene is a 145 kD receptor tyrosine kinase family closely related to platelet-derived growth factor receptor (PDGFR). It is a transmembrane receptor and the cellular homolog of the HZ4-feline sarcoma virus transforming gene ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | KIT |