CCL14/HCC-1/HCC-3 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CCL14 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for CCL14/HCC-1/HCC-3 Antibody
Background
The CCL14 gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokinesare secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes inintracellular calcium
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: BA, BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: ELISA
Species: Mu
Applications: Neut, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: Neut, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Publications for CCL14/HCC-1/HCC-3 Antibody (NBP1-85595) (0)
There are no publications for CCL14/HCC-1/HCC-3 Antibody (NBP1-85595).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CCL14/HCC-1/HCC-3 Antibody (NBP1-85595) (0)
There are no reviews for CCL14/HCC-1/HCC-3 Antibody (NBP1-85595).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CCL14/HCC-1/HCC-3 Antibody (NBP1-85595) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CCL14/HCC-1/HCC-3 Products
Research Areas for CCL14/HCC-1/HCC-3 Antibody (NBP1-85595)
Find related products by research area.
|
Blogs on CCL14/HCC-1/HCC-3