Home » Carboxyl Ester Lipase/CEL » CEL Peptides and Proteins » Carboxyl Ester Lipase/CEL Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Carboxyl Ester Lipase/CEL Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Carboxyl Ester Lipase/CEL Protein (NBP1-88502PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Carboxyl Ester Lipase/CEL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CEL.

Source: E. coli

Amino Acid Sequence: HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CEL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88502.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Carboxyl Ester Lipase/CEL Recombinant Protein Antigen

  • BAL
  • bile salt-activated lipase
  • Bile salt-stimulated lipase
  • BSDL
  • BSSL
  • BSSLbile salt-dependent lipase, oncofetal isoform
  • bucelipase
  • carboxyl ester hydrolase
  • carboxyl ester lipase (bile salt-stimulated lipase)
  • Carboxyl Ester Lipase
  • CEase
  • CEL
  • CELL
  • Cholesterol esterase
  • EC 3.1.1
  • EC 3.1.1.13
  • EC 3.1.1.3
  • FAP
  • FAPP
  • fetoacinar pancreatic protein
  • LIPA
  • lysophospholipase, pancreatic
  • MODY8bile-salt-activated lipase
  • Pancreatic lysophospholipase
  • Sterol esterase

Background

CEL - carboxyl ester lipase (bile salt-stimulated lipase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Hormone-sensitive
Lipase/HSL Antibody
NB110-37253
Western Blot Hormone-sensitive Lipase/HSL Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/ Immunofluorescence APC Antibody - BSA Free
Flow Cytometry APC Antibody - BSA Free
Immunohistochemistry-Paraffin APC Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Transthyretin/Prealbum ...
NBP2-52575
Flow Cytometry Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Carboxylesterase
1/CES1 Antibody
NBP1-85691
Simple Western Carboxylesterase 1/CES1 Antibody
Simple Western Carboxylesterase 1/CES1 Antibody
Western Blot Carboxylesterase 1/CES1 Antibody
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Coagulation Factor
XIV/Protein C Antibod ...
NBP1-86509
Immunohistochemistry-Paraffin Coagulation Factor XIV/Protein C Antibody
Immunohistochemistry-Paraffin Coagulation Factor XIV/Protein C Antibody
Immunohistochemistry-Paraffin Coagulation Factor XIV/Protein C Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PEDFR/PNPLA2/ATGL
Antibody [Unconjugate ...
AF5365
Western Blot PEDFR/PNPLA2/ATGL Antibody [Unconjugated]
Simple Western PEDFR/PNPLA2/ATGL Antibody [Unconjugated]
Immunohistochemistry PEDFR/PNPLA2/ATGL Antibody [Unconjugated]
(10 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
DPPIV/CD26
Antibody [Unconjugate
AF1180
Simple Western DPPIV/CD26 Antibody [Unconjugated]
Immunohistochemistry DPPIV/CD26 Antibody [Unconjugated]
Immunocytochemistry DPPIV/CD26 Antibody [Unconjugated]
(2 Reviews)
(55 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
SOAT1 Antibody
NB400-141
SOAT1 Antibody
(7 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
EPHX2 Antibody
(OTI1A6)
NBP2-02948
Western Blot EPHX2 Antibody (OTI1A6)
Immunohistochemistry-Paraffin EPHX2 Antibody (OTI1A6)
Immunohistochemistry-Paraffin EPHX2 Antibody (OTI1A6)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ACAT1 Antibody
NBP1-89284
Western Blot ACAT1 Antibody
Immunocytochemistry/ Immunofluorescence ACAT1 Antibody
Immunohistochemistry-Paraffin ACAT1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Carboxyl Ester
Lipase/CEL Recombinan ...
NBP1-88502PEP
Carboxyl Ester Lipase/CEL Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Carboxyl Ester Lipase/CEL Protein (NBP1-88502PEP) (0)

There are no publications for Carboxyl Ester Lipase/CEL Protein (NBP1-88502PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carboxyl Ester Lipase/CEL Protein (NBP1-88502PEP) (0)

There are no reviews for Carboxyl Ester Lipase/CEL Protein (NBP1-88502PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Carboxyl Ester Lipase/CEL Protein (NBP1-88502PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carboxyl Ester Lipase/CEL Products

Research Areas for Carboxyl Ester Lipase/CEL Protein (NBP1-88502PEP)

Find related products by research area.

Blogs on Carboxyl Ester Lipase/CEL

There are no specific blogs for Carboxyl Ester Lipase/CEL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Simple Western lane view shows lysates of LoVo human colorectal adenocarcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for DPPIV/CD26 at approximately 168 kDa (as indicated) using 2 µg/mL of Goat Anti-Human DPPIV/CD26 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1180) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
DPPIV/CD26 Antibody [Unconjugated]
AF1180

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Carboxyl Ester Lipase/CEL Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CEL