![Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining in human heart muscle and skin tissues using anti-CASQ2 antibody. Corresponding CASQ2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Calsequestrin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-87304-img0009.jpg "Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining in human heart muscle and skin tissues using anti-CASQ2 antibody. Corresponding CASQ2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVL |
| Predicted Species | Mouse (94%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CASQ2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87304 | Applications | Species |
|---|---|---|
| Kim JH, Lee ES, Yun J et al. Calsequestrin 2 overexpression in breast cancer increases tumorigenesis and metastasis by modulating the tumor microenvironment Molecular Oncology 2022-01-01 [PMID: 34743414] (Immunohistochemistry) | Immunohistochemistry |
Secondary Antibodies |
Isotype Controls |
Research Areas for Calsequestrin 2 Antibody (NBP1-87304)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CASQ2 |
![Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human heart muscle, lymph node, skeletal muscle and skin using Anti-CASQ2 antibody NBP1-87304 (A) shows similar protein distribution across tissues to independent antibody NBP2-33747 (B).](http://images.novusbio.com/fullsize/Calsequestrin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-87304-img0010.jpg "Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human heart muscle, lymph node, skeletal muscle and skin using Anti-CASQ2 antibody NBP1-87304 (A) shows similar protein distribution across tissues to independent antibody NBP2-33747 (B).")
![Western Blot: Calsequestrin 2 Antibody [NBP1-87304] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-93](http://images.novusbio.com/fullsize/Calsequestrin-2-Antibody-Western-Blot-NBP1-87304-img0005.jpg "Western Blot: Calsequestrin 2 Antibody [NBP1-87304] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-93")
![Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human skeletal muscle.](http://images.novusbio.com/fullsize/Calsequestrin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-87304-img0012.jpg "Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human skeletal muscle.")
![Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human heart muscle shows high expression.](http://images.novusbio.com/fullsize/Calsequestrin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-87304-img0007.jpg "Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human heart muscle shows high expression.")
![Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human skin shows low expression as expected.](http://images.novusbio.com/fullsize/Calsequestrin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-87304-img0008.jpg "Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human skin shows low expression as expected.")
![Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human lymph node.](http://images.novusbio.com/fullsize/Calsequestrin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-87304-img0011.jpg "Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human lymph node.")
![Western Blot FKBP12.6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP12.6_AF4174_Western_Blot_5411.jpg)
![Simple Western FKBP12.6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP12.6_AF4174_Simple_Western_16756.jpg)
![Immunohistochemistry FKBP12.6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP12.6_AF4174_Immunohistochemistry_22269.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")