![Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Staining of human lymph node shows no positivity in lymphoid cells as expected.](http://images.novusbio.com/fullsize/BRUNOL4-Antibody-Immunohistochemistry-Paraffin-NBP1-89932-img0008.jpg "Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Staining of human lymph node shows no positivity in lymphoid cells as expected.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDH |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CELF4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CELF4 |
![Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/BRUNOL4-Antibody-Immunohistochemistry-Paraffin-NBP1-89932-img0005.jpg "Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Analysis in human cerebral cortex and kidney tissues using NBP1-89932 antibody. Corresponding CELF4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/BRUNOL4-Antibody-Immunohistochemistry-Paraffin-NBP1-89932-img0006.jpg "Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Analysis in human cerebral cortex and kidney tissues using NBP1-89932 antibody. Corresponding CELF4 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Staining of human duodenum shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/BRUNOL4-Antibody-Immunohistochemistry-Paraffin-NBP1-89932-img0007.jpg "Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Staining of human duodenum shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/BRUNOL4-Antibody-Immunohistochemistry-Paraffin-NBP1-89932-img0009.jpg "Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunocytochemistry Cardiac Troponin T Antibody (200805) [Unconjugated] - (Cardiac)](https://images.novusbio.com/images2/Troponin_T_MAB1874_Immunocytochemistry_15884.jpg)
![Immunohistochemistry Cardiac Troponin T Antibody (200805) [Unconjugated] - (Cardiac)](https://images.novusbio.com/images2/Troponin_T_MAB1874_Immunohistochemistry_17796.jpg)
![Immunohistochemistry Neuregulin-3/NRG3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuregulin-3_AF753_Immunohistochemistry_10200.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")