![Western Blot: BRIP1/FANCJ Antibody [NBP2-14361] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-BRIP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/BRIP1-FANCJ-Antibody-Western-Blot-NBP2-14361-img0006.jpg "Western Blot: BRIP1/FANCJ Antibody [NBP2-14361] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-BRIP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: FNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPEL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BRIP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for BRIP1/FANCJ Antibody (NBP2-14361)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BRIP1 |
![Immunocytochemistry/Immunofluorescence: BRIP1/FANCJ Antibody [NBP2-14361] - Staining of human cell line A-431 shows positivity in nucleus and nuclear membrane.](http://images.novusbio.com/fullsize/BRIP1-FANCJ-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14361-img0003.jpg "Immunocytochemistry/Immunofluorescence: BRIP1/FANCJ Antibody [NBP2-14361] - Staining of human cell line A-431 shows positivity in nucleus and nuclear membrane.")
![Immunohistochemistry-Paraffin: BRIP1/FANCJ Antibody [NBP2-14361] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.](http://images.novusbio.com/fullsize/BRIP1-FANCJ-Antibody-Immunohistochemistry-Paraffin-NBP2-14361-img0001.jpg "Immunohistochemistry-Paraffin: BRIP1/FANCJ Antibody [NBP2-14361] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.")
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Western Blot Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Western_Blot_5130.jpg)
![Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Immunocytochemistry__Immunofluorescence_18847.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")