![Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining in human placenta and pancreas tissues using anti-BNIP3L antibody. Corresponding BNIP3L RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/BNIP3L-Antibody-Immunohistochemistry-Paraffin-NBP1-88558-img0009.jpg "Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining in human placenta and pancreas tissues using anti-BNIP3L antibody. Corresponding BNIP3L RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BNIP3L |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for BNIP3L Antibody (NBP1-88558)Find related products by research area.
|
|
Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease By Jamshed Arslan Pharm.D. Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BNIP3L |
![Western Blot: BNIP3L Antibody [NBP1-88558] - UCB-hMSCs were exposed to normoxia or hypoxia. (D) The mRNA expressions of PINK1, BNIP3, NIX and FUNDC1 were analyzed by quantitative real-time PCR (qPCR). n = 5. (E) The protein expressions of PINK1, BNIP3, NIX and B-actin were assessed by western blot. n = 4. *p < 0.05 versus control. Image collected and cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/BNIP3L-Antibody-Western-Blot-NBP1-88558-img0010.jpg "Western Blot: BNIP3L Antibody [NBP1-88558] - UCB-hMSCs were exposed to normoxia or hypoxia. (D) The mRNA expressions of PINK1, BNIP3, NIX and FUNDC1 were analyzed by quantitative real-time PCR (qPCR). n = 5. (E) The protein expressions of PINK1, BNIP3, NIX and B-actin were assessed by western blot. n = 4. *p < 0.05 versus control. Image collected and cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804) licensed under a CC-BY license.")
![Western Blot: BNIP3L Antibody [NBP1-88558] - Vehicle or RU 486 (5 mg/kg) injected mice were presented with/without corticosterone (10 mg/kg) for 3 days. The expressions of peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC1 alpha NBP1-04676) and NIX (BNIP3L NBP1-88558) were visualized via western blotting. Loading control is beta-actin. n = 5. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33473105/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/BNIP3L Antibody-Western Blot-NBP1-88558-img0011.jpg "Western Blot: BNIP3L Antibody [NBP1-88558] - Vehicle or RU 486 (5 mg/kg) injected mice were presented with/without corticosterone (10 mg/kg) for 3 days. The expressions of peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC1 alpha NBP1-04676) and NIX (BNIP3L NBP1-88558) were visualized via western blotting. Loading control is beta-actin. n = 5. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33473105/) licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: BNIP3L Antibody [NBP1-88558] - Staining of human cell line U-2 OS shows localization to nuclear speckles & mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/BNIP3L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88558-img0006.jpg "Immunocytochemistry/Immunofluorescence: BNIP3L Antibody [NBP1-88558] - Staining of human cell line U-2 OS shows localization to nuclear speckles & mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/BNIP3L-Antibody-Immunohistochemistry-Paraffin-NBP1-88558-img0007.jpg "Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining of human placenta shows high expression.](http://images.novusbio.com/fullsize/BNIP3L-Antibody-Immunohistochemistry-Paraffin-NBP1-88558-img0008.jpg "Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining of human placenta shows high expression.")
![Western Blot: BNIP3L Antibody [NBP1-88558] - Role of PGC1 alpha in NIX-dependent mitophagy.a–e Nontargeting (NT) or GR siRNA was transfected to hippocampal neurons & SH-SY5Y cells for 24 h prior to corticosterone & cortisol for 12 h, respectively. a, b Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC1 alpha ) expression was detected in western blot where beta -actin was used as a loading control in both cell types. n = 5. c Colocalization of PGC1 alpha (red) & DAPI (blue) in hippocampal neurons was visualized with SRRF imaging system. Scale bars, 20 μm (magnification, ×1000). n = 5. d Colocalization of PGC1 alpha (green) & DAPI (blue) in SH-SY5Y was visualized with SRRF imaging system. Scale bars, 20 μm (magnification, ×1000). n = 5. e PGC1 alpha protein expressions in subcellular fraction samples were detected by western blotting. Lamin A/C & alpha -tubulin were used as a nuclear & cytosolic loading control, respectively. n = 5. f, g SH-SY5Y cells were transfected with pcDNA3.1/c-eGFP or pcDNA3.1/PPARGC1A-c-eGFP vector for 24 h prior to cortisol treatment for 24 h. f NIX expression was detected in western blot where beta -actin was used as a loading control. n = 5. g TOMM20 levels were detected by western blot. Loading control for western blot is beta -actin. n = 5. All blots & immunofluorescence images are representative. n = 5 from independent experiments with two technical replicates each. Quantitative data are presented as a mean ± S.E.M. Two-sided two-way ANOVA was conducted. ** indicates p < 0.01 versus control. #, ## indicates p < 0.05, p < 0.01 versus corticosterone in hippocampal neurons & cortisol in SH-SY5Y, respectively. Data are provided as a Source data file. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33473105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88558_rabbit-polyclonal-bnip3l-antibody-310202416121937.jpg "Western Blot: BNIP3L Antibody [NBP1-88558] - Role of PGC1 alpha in NIX-dependent mitophagy.a–e Nontargeting (NT) or GR siRNA was transfected to hippocampal neurons & SH-SY5Y cells for 24 h prior to corticosterone & cortisol for 12 h, respectively. a, b Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC1 alpha ) expression was detected in western blot where beta -actin was used as a loading control in both cell types. n = 5. c Colocalization of PGC1 alpha (red) & DAPI (blue) in hippocampal neurons was visualized with SRRF imaging system. Scale bars, 20 μm (magnification, ×1000). n = 5. d Colocalization of PGC1 alpha (green) & DAPI (blue) in SH-SY5Y was visualized with SRRF imaging system. Scale bars, 20 μm (magnification, ×1000). n = 5. e PGC1 alpha protein expressions in subcellular fraction samples were detected by western blotting. Lamin A/C & alpha -tubulin were used as a nuclear & cytosolic loading control, respectively. n = 5. f, g SH-SY5Y cells were transfected with pcDNA3.1/c-eGFP or pcDNA3.1/PPARGC1A-c-eGFP vector for 24 h prior to cortisol treatment for 24 h. f NIX expression was detected in western blot where beta -actin was used as a loading control. n = 5. g TOMM20 levels were detected by western blot. Loading control for western blot is beta -actin. n = 5. All blots & immunofluorescence images are representative. n = 5 from independent experiments with two technical replicates each. Quantitative data are presented as a mean ± S.E.M. Two-sided two-way ANOVA was conducted. ** indicates p < 0.01 versus control. #, ## indicates p < 0.05, p < 0.01 versus corticosterone in hippocampal neurons & cortisol in SH-SY5Y, respectively. Data are provided as a Source data file. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33473105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: BNIP3L Antibody [NBP1-88558] - GR-dependent downregulation of NIX expression via PGC1 alpha .a, b Nontargeting (NT) or GR siRNA was transfected to hippocampal neurons & SH-SY5Y cells for 24 h prior to corticosterone & cortisol for 24 h, respectively. NIX expression was detected in western blot where beta -actin was used as a loading control. n = 5. c SH-SY5Y cells were incubated with cortisol for 6 h. The mRNA expression levels of genes associated with nuclear receptors & coregulators were assessed by RT2 Profiler PCR array. Heat maps with hierarchical clustering were acquired by using the GeneGlobe Data analysis Center on Qiagen website. n = 3. d A thousand base pair upstream of the first codon of the PPARGC1A was described & the putative GRE binding sequence was emphasized with yellow labeling. e SH-SY5Y cells were incubated with cortisol for 6 h. DNA was immunoprecipitated with IgG, RNA polymerase (RNAPol), & glucocorticoid receptor (GR) antibody. The immunoprecipitation & input samples were amplified with primers of GAPDH & PPARGC1A gene. n = 5. All blots are representative. n = 3 or 5 from independent experiments with two technical replicates each, respectively. Quantitative data are presented as a mean ± S.E.M. Two-sided two-way ANOVA was conducted in Fig. 6a, b. Two-sided unpaired student’s t test was conducted in Fig. 6e. ** indicates p < 0.01 versus control. ## indicates p < 0.01 versus corticosterone in hippocampal neurons & cortisol in SH-SY5Y, respectively. Data are provided as a Source data file. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33473105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88558_rabbit-polyclonal-bnip3l-antibody-310202416121914.jpg "Western Blot: BNIP3L Antibody [NBP1-88558] - GR-dependent downregulation of NIX expression via PGC1 alpha .a, b Nontargeting (NT) or GR siRNA was transfected to hippocampal neurons & SH-SY5Y cells for 24 h prior to corticosterone & cortisol for 24 h, respectively. NIX expression was detected in western blot where beta -actin was used as a loading control. n = 5. c SH-SY5Y cells were incubated with cortisol for 6 h. The mRNA expression levels of genes associated with nuclear receptors & coregulators were assessed by RT2 Profiler PCR array. Heat maps with hierarchical clustering were acquired by using the GeneGlobe Data analysis Center on Qiagen website. n = 3. d A thousand base pair upstream of the first codon of the PPARGC1A was described & the putative GRE binding sequence was emphasized with yellow labeling. e SH-SY5Y cells were incubated with cortisol for 6 h. DNA was immunoprecipitated with IgG, RNA polymerase (RNAPol), & glucocorticoid receptor (GR) antibody. The immunoprecipitation & input samples were amplified with primers of GAPDH & PPARGC1A gene. n = 5. All blots are representative. n = 3 or 5 from independent experiments with two technical replicates each, respectively. Quantitative data are presented as a mean ± S.E.M. Two-sided two-way ANOVA was conducted in Fig. 6a, b. Two-sided unpaired student’s t test was conducted in Fig. 6e. ** indicates p < 0.01 versus control. ## indicates p < 0.01 versus corticosterone in hippocampal neurons & cortisol in SH-SY5Y, respectively. Data are provided as a Source data file. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33473105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: BNIP3L Antibody [NBP1-88558] - GR-dependent downregulation of NIX expression via PGC1 alpha .a, b Nontargeting (NT) or GR siRNA was transfected to hippocampal neurons & SH-SY5Y cells for 24 h prior to corticosterone & cortisol for 24 h, respectively. NIX expression was detected in western blot where beta -actin was used as a loading control. n = 5. c SH-SY5Y cells were incubated with cortisol for 6 h. The mRNA expression levels of genes associated with nuclear receptors & coregulators were assessed by RT2 Profiler PCR array. Heat maps with hierarchical clustering were acquired by using the GeneGlobe Data analysis Center on Qiagen website. n = 3. d A thousand base pair upstream of the first codon of the PPARGC1A was described & the putative GRE binding sequence was emphasized with yellow labeling. e SH-SY5Y cells were incubated with cortisol for 6 h. DNA was immunoprecipitated with IgG, RNA polymerase (RNAPol), & glucocorticoid receptor (GR) antibody. The immunoprecipitation & input samples were amplified with primers of GAPDH & PPARGC1A gene. n = 5. All blots are representative. n = 3 or 5 from independent experiments with two technical replicates each, respectively. Quantitative data are presented as a mean ± S.E.M. Two-sided two-way ANOVA was conducted in Fig. 6a, b. Two-sided unpaired student’s t test was conducted in Fig. 6e. ** indicates p < 0.01 versus control. ## indicates p < 0.01 versus corticosterone in hippocampal neurons & cortisol in SH-SY5Y, respectively. Data are provided as a Source data file. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33473105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88558_rabbit-polyclonal-bnip3l-antibody-310202416121960.jpg "Western Blot: BNIP3L Antibody [NBP1-88558] - GR-dependent downregulation of NIX expression via PGC1 alpha .a, b Nontargeting (NT) or GR siRNA was transfected to hippocampal neurons & SH-SY5Y cells for 24 h prior to corticosterone & cortisol for 24 h, respectively. NIX expression was detected in western blot where beta -actin was used as a loading control. n = 5. c SH-SY5Y cells were incubated with cortisol for 6 h. The mRNA expression levels of genes associated with nuclear receptors & coregulators were assessed by RT2 Profiler PCR array. Heat maps with hierarchical clustering were acquired by using the GeneGlobe Data analysis Center on Qiagen website. n = 3. d A thousand base pair upstream of the first codon of the PPARGC1A was described & the putative GRE binding sequence was emphasized with yellow labeling. e SH-SY5Y cells were incubated with cortisol for 6 h. DNA was immunoprecipitated with IgG, RNA polymerase (RNAPol), & glucocorticoid receptor (GR) antibody. The immunoprecipitation & input samples were amplified with primers of GAPDH & PPARGC1A gene. n = 5. All blots are representative. n = 3 or 5 from independent experiments with two technical replicates each, respectively. Quantitative data are presented as a mean ± S.E.M. Two-sided two-way ANOVA was conducted in Fig. 6a, b. Two-sided unpaired student’s t test was conducted in Fig. 6e. ** indicates p < 0.01 versus control. ## indicates p < 0.01 versus corticosterone in hippocampal neurons & cortisol in SH-SY5Y, respectively. Data are provided as a Source data file. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33473105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: BNIP3L Antibody [NBP1-88558] - Effects of hypoxia on mitophagy regulator expressions & mitophagy in UCB-hMSCs. (A) UCB-hMSCs incubated w/ various times of hypoxia (0–48 h). Cells stained w/ Mitotracker™. n = 6 (magnification, ×1,200). Scale bars, 50 µm. (B) The expressions of COX4 & beta -actin detected by western blot. n = 4. (C) UCB-hMSCs exposed to 24 h of normoxia or hypoxia. Cells immuno-stained w/ COX4 & LC3B-specific antibodies (magnification, ×600). Scale bars, 37.5 µm. (D) The mRNA expressions of PINK1, BNIP3, NIX & FUNDC1 analyzed by quantitative real-time PCR (qPCR). n = 5. (E) The protein expressions of PINK1, BNIP3, NIX & beta -actin assessed by western blot. n = 4. (F, G) siRNAs of PINK1, BNIP3, NIX or non-targeting (NT) transfected to UCB-hMSCs prior to hypoxia treatment for 24 h. COX4 & beta -actin expressions assessed by western blot. n = 4 (F). Cells immunostained w/ COX4 & PI. n = 3 (magnification, ×400). All scale bars, 50 µm. COX4 fluorescence intensity analyzed by luminometer. n = 5 (G). (H) BNIP3 siRNA transfected to UCB-hMSCs prior to hypoxia treatment for 24 h. Cells stained w/ Mitotracker™. n = 6 (magnification, ×1,200). Scale bars, 50 µm. (I) BNIP3, beta -tubulin & COX4 w/ cytosol & mitochondrial fractionized samples detected by western blot. (J) Cells incubated w/ hypoxia or normoxia for 24 h. Cells immuno-stained w/ BNIP3 & LC3B-specific antibodies. (magnification, ×600). Scale bars, 37.5 µm. Western blot data normalized by beta -actin, & qPCR data normalized by ACTB mRNA expression level. Quantitative data are presented as a mean ± S.E.M. All blot & confocal images are representative. *p < 0.05 versus control, #p < 0.05 versus hypoxia. Image collected & cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88558_rabbit-polyclonal-bnip3l-antibody-310202416121983.jpg "Western Blot: BNIP3L Antibody [NBP1-88558] - Effects of hypoxia on mitophagy regulator expressions & mitophagy in UCB-hMSCs. (A) UCB-hMSCs incubated w/ various times of hypoxia (0–48 h). Cells stained w/ Mitotracker™. n = 6 (magnification, ×1,200). Scale bars, 50 µm. (B) The expressions of COX4 & beta -actin detected by western blot. n = 4. (C) UCB-hMSCs exposed to 24 h of normoxia or hypoxia. Cells immuno-stained w/ COX4 & LC3B-specific antibodies (magnification, ×600). Scale bars, 37.5 µm. (D) The mRNA expressions of PINK1, BNIP3, NIX & FUNDC1 analyzed by quantitative real-time PCR (qPCR). n = 5. (E) The protein expressions of PINK1, BNIP3, NIX & beta -actin assessed by western blot. n = 4. (F, G) siRNAs of PINK1, BNIP3, NIX or non-targeting (NT) transfected to UCB-hMSCs prior to hypoxia treatment for 24 h. COX4 & beta -actin expressions assessed by western blot. n = 4 (F). Cells immunostained w/ COX4 & PI. n = 3 (magnification, ×400). All scale bars, 50 µm. COX4 fluorescence intensity analyzed by luminometer. n = 5 (G). (H) BNIP3 siRNA transfected to UCB-hMSCs prior to hypoxia treatment for 24 h. Cells stained w/ Mitotracker™. n = 6 (magnification, ×1,200). Scale bars, 50 µm. (I) BNIP3, beta -tubulin & COX4 w/ cytosol & mitochondrial fractionized samples detected by western blot. (J) Cells incubated w/ hypoxia or normoxia for 24 h. Cells immuno-stained w/ BNIP3 & LC3B-specific antibodies. (magnification, ×600). Scale bars, 37.5 µm. Western blot data normalized by beta -actin, & qPCR data normalized by ACTB mRNA expression level. Quantitative data are presented as a mean ± S.E.M. All blot & confocal images are representative. *p < 0.05 versus control, #p < 0.05 versus hypoxia. Image collected & cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88558_rabbit-polyclonal-bnip3l-antibody-310202416113531.jpg "Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88558_rabbit-polyclonal-bnip3l-antibody-310202416114791.jpg "Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88558_rabbit-polyclonal-bnip3l-antibody-310202416114754.jpg "Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88558_rabbit-polyclonal-bnip3l-antibody-310202416121953.jpg "Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88558_rabbit-polyclonal-bnip3l-antibody-31020241613647.jpg "Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Western_Blot_5904.jpg)
![Immunocytochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Immunocytochemistry__Immunofluorescence_22091.jpg)
![Immunohistochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images/af816_human-bak-affinity-purified-polyclonal-ab-immunohistochemistry-26420239384.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Simple Western BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Simple_Western_16992.jpg)
![Western Blot BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Western_Blot_22585.jpg)
![Western Blot BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Western_Blot_9663.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")