![Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP1-81984] - Analysis in human fallopian tube and prostate tissues using NBP1-81984 antibody. Corresponding SPATA18 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SPATA18-Antibody-Immunohistochemistry-Paraffin-NBP1-81984-img0020.jpg "Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP1-81984] - Analysis in human fallopian tube and prostate tissues using NBP1-81984 antibody. Corresponding SPATA18 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTAAAQEGGRNDGVETIKSR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SPATA18 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 61 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-81984 | Applications | Species |
|---|---|---|
| Brahimi-Horn MC, Lacas-Gervais S, Adaixo R et al. Local mitochondrial-endolysosomal microfusion cleaves the voltage-dependent anion channel 1 to promote survival in hypoxia Mol. Cell. Biol. 2015-02-17 [PMID: 25691661] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP1-81984] - Staining of human fallopian tube shows strong positivity in cilia in glandular cells.](http://images.novusbio.com/fullsize/SPATA18-Antibody-Immunohistochemistry-Paraffin-NBP1-81984-img0016.jpg "Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP1-81984] - Staining of human fallopian tube shows strong positivity in cilia in glandular cells.")
![Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP1-81984] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/SPATA18-Antibody-Immunohistochemistry-Paraffin-NBP1-81984-img0017.jpg "Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP1-81984] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP1-81984] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/SPATA18-Antibody-Immunohistochemistry-Paraffin-NBP1-81984-img0018.jpg "Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP1-81984] - Staining of human prostate shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP1-81984] - Staining of human skin shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/SPATA18-Antibody-Immunohistochemistry-Paraffin-NBP1-81984-img0019.jpg "Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP1-81984] - Staining of human skin shows no positivity in squamous epithelial cells as expected.")
![Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP1-81984] - Staining of human fallopian tube, lymph node, prostate and skin using Anti-SPATA18 antibody NBP1-81984 (A) shows similar protein distribution across tissues to independent antibody (B).](http://images.novusbio.com/fullsize/antibody/nbp1-81984_rabbit-polyclonal-spata18-antibody-immunohistochemistry-paraffin-1532024134211.jpg "Immunohistochemistry-Paraffin: SPATA18 Antibody [NBP1-81984] - Staining of human fallopian tube, lymph node, prostate and skin using Anti-SPATA18 antibody NBP1-81984 (A) shows similar protein distribution across tissues to independent antibody (B).")
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry__Immunofluorescence_17000.jpg)
![Western Blot CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Western_Blot_11997.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry_12002.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")