Home » BNIP3 » BNIP3 Proteins » BNIP3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

BNIP3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for BNIP3 Protein (NBP1-82566PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

BNIP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BNIP3.

Source: E. coli

Amino Acid Sequence: MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BNIP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82566.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BNIP3 Recombinant Protein Antigen

  • BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
  • BCL2/adenovirus E1B 19kDa interacting protein 3
  • BCL2/adenovirus E1B 19kD-interacting protein 3
  • BNIP3
  • Nip3

Background

BCL2/adenovirus E1B 19kD protein-interacting protein 3 (BNIP3) is a mitochondrial protein critical for apoptotic events in response to adenovirus infection. It has been implicated in causing a necrotic-like cell death pattern in cells, induced by CD47. This effect has been seen in many cancer cells, and its mis-regulation causes tumor cells to be impervious to normal autophagic events. The tumor suppressor p53 represses the expression of BNIP3, often as a consequence of hypoxic micro-environments as seen in tumors. When BNIP3 is correctly expressed and activated, it translocates to the mitochondria and instigates apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(26 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
BNIP3L Antibody
NBP1-88558
Immunohistochemistry-Paraffin BNIP3L Antibody
Immunohistochemistry-Paraffin BNIP3L Antibody
Immunohistochemistry-Paraffin BNIP3L Antibody
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
HIF-1 alpha
Antibody (H1alpha67)
NB100-105
Western Blot HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
(45 Reviews)
(1043 Publications)
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(684 Publications)
Species: Hu
Applications: ELISA
Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
HYPB Antibody -
Azide and BSA Free
NBP3-03807
Immunocytochemistry/ Immunofluorescence HYPB Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HYPB Antibody - Azide and BSA Free
Western Blot HYPB Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot Bax Antibody (6A7)
Western Blot Bax Antibody (6A7)
Immunohistochemistry-Frozen Bax Antibody (6A7)
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Beclin 1 Antibody
- BSA Free
NB500-249
Western Blot Beclin 1 Antibody - BSA Free
Simple Western Beclin 1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Beclin 1 Antibody - BSA Free
(9 Reviews)
(163 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
LC3A Antibody -
BSA Free
NB100-2331
Western Blot LC3A Antibody - BSA Free
Simple Western LC3A Antibody - BSA Free
Western Blot LC3A Antibody - BSA Free
(22 Reviews)
(306 Publications)
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
Glut1 Antibody -
BSA Free
NB110-39113
Western Blot Glut1 Antibody - BSA Free
Flow Cytometry Glut1 Antibody - BSA Free
Western Blot Glut1 Antibody - BSA Free
(7 Reviews)
(62 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
HIF-2 alpha/EPAS1
Antibody - BSA Free
NB100-122
Immunohistochemistry HIF-2 alpha/EPAS1 Antibody - BSA Free
Immunohistochemistry HIF-2 alpha/EPAS1 Antibody - BSA Free
Western Blot HIF-2 alpha/EPAS1 Antibody - BSA Free
(37 Reviews)
(826 Publications)
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
BID Antibody
[Unconjugated]
AF860
Simple Western BID Antibody [Unconjugated]
Western Blot BID Antibody [Unconjugated]
Western Blot BID Antibody [Unconjugated]
(1 Review)
(39 Publications)
Species: Hu, Mu
Applications: IP, Simple Western, WB
BNIP3 Recombinant
Protein Antigen
NBP1-82566PEP
BNIP3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for BNIP3 Protein (NBP1-82566PEP) (0)

There are no publications for BNIP3 Protein (NBP1-82566PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BNIP3 Protein (NBP1-82566PEP) (0)

There are no reviews for BNIP3 Protein (NBP1-82566PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BNIP3 Protein (NBP1-82566PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BNIP3 Products

Research Areas for BNIP3 Protein (NBP1-82566PEP)

Find related products by research area.

Blogs on BNIP3.

Check out the latest blog posts on BNIP3.
BNIP3 - a regulator of mitochondrial autophagy and cell death
Bcl-2 nineteen-kilodalton interacting protein 3 (BNIP3) is a pro-apoptotic BH3-only protein. BNIP3 localizes to the mitochondrial membrane where it plays a key role in mitochondrial autophagy and cell death pathways. Similar to other Bcl-2 family m...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Naive CD4 T cells from WT, VHL-deficient (Vhl KO), or HIF-1 alpha-deficient (HIF-1 alpha KO) mice were differentiated under IL-22-skewing conditions for a total of 60 h. Some cells remained at normoxia for the duration of the culture (N); others were at normoxia for 35 h and then hypoxia (1% O2) for 24 h (H). At 60 h, nuclear extracts were harvested, and HIF-1 alpha and Lamin B1 levels were analyzed by Western blot. Image from verified customer review.
HIF-1 alpha Antibody (H1alpha67)
NB100-105
Western Blot: BNIP3 Antibody [NB100-56150] - BNIP3 expression in porcine whole skeletal muscle lysate. Image from verified customer review.
BNIP3 Antibody
NB100-56150
Expression and correlation of 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF in ccRCC. (A, C & E) Positive nuclear staining to the 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF, in primary ccRCCs at high magnification (100X). (B, D & F) Heterogenous nuclear staining of 3 antibodies in a tumor at low magnification (20X). (G, H and I). Correlation of 3 antibodies with the Fuhrman grade.Citation: Ambrosetti D, Dufies M, Dadone B, Durand M, Borchiellini D, Amiel J, et al. (2018) The two glycolytic markers GLUT1 and MCT1 correlate with tumor grade and survival in clear-cell renal cell carcinoma. PLoS ONE 13(2): e0193477. https://doi.org/10.1371/journal.pone.0193477
HIF-2 alpha/EPAS1 Antibody - BSA Free
NB100-122

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BNIP3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BNIP3