![Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Analysis in human placenta and skeletal muscle tissues. Corresponding BGN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Biglycan-Antibody-Immunohistochemistry-Paraffin-NBP1-84971-img0018.jpg "Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Analysis in human placenta and skeletal muscle tissues. Corresponding BGN RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL |
| Predicted Species | Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BGN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF1060_Simple_Western_18969.jpg)
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF1060_Western_Blot_19006.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images/af1060_mouse-decorin-affinity-purified-polyclonal-ab-8120255552891.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Biglycan Antibody (NBP1-84971)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BGN |
![Western Blot: Biglycan Antibody [NBP1-84971] - Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression. Western blot showing the effects of bFGF, EGF and TGF beta 1 treatment (10 ng/ml) on the expression of biglycan in CAFs. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25593993/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Biglycan-Antibody-Western-Blot-NBP1-84971-img0019.jpg "Western Blot: Biglycan Antibody [NBP1-84971] - Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression. Western blot showing the effects of bFGF, EGF and TGF beta 1 treatment (10 ng/ml) on the expression of biglycan in CAFs. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25593993/) licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: Biglycan Antibody [NBP1-84971] - Staining of human cell line BJ shows localization to endoplasmic reticulum & the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Biglycan-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84971-img0006.jpg "Immunocytochemistry/Immunofluorescence: Biglycan Antibody [NBP1-84971] - Staining of human cell line BJ shows localization to endoplasmic reticulum & the Golgi apparatus. Antibody staining is shown in green.")
![Western Blot: Biglycan Antibody [NBP1-84971] - Analysis in human cell line U-138 MG.](http://images.novusbio.com/fullsize/Biglycan-Antibody-Western-Blot-NBP1-84971-img0005.jpg "Western Blot: Biglycan Antibody [NBP1-84971] - Analysis in human cell line U-138 MG.")
![Western Blot: Biglycan Antibody [NBP1-84971] - Analysis in control (vector only transfected HEK293T lysate) and BGN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Biglycan-Antibody-Western-Blot-NBP1-84971-img0013.jpg "Western Blot: Biglycan Antibody [NBP1-84971] - Analysis in control (vector only transfected HEK293T lysate) and BGN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human testis shows weak to moderate cytoplasmic positivity in peritubular myoid cells.](http://images.novusbio.com/fullsize/Biglycan-Antibody-Immunohistochemistry-Paraffin-NBP1-84971-img0014.jpg "Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human testis shows weak to moderate cytoplasmic positivity in peritubular myoid cells.")
![Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Biglycan-Antibody-Immunohistochemistry-Paraffin-NBP1-84971-img0016.jpg "Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human kidney shows moderate extracellular space positivity.](http://images.novusbio.com/fullsize/Biglycan-Antibody-Immunohistochemistry-Paraffin-NBP1-84971-img0015.jpg "Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human kidney shows moderate extracellular space positivity.")
![Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Biglycan-Antibody-Immunohistochemistry-Paraffin-NBP1-84971-img0017.jpg "Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot: Biglycan Antibody [NBP1-84971] - Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. (B) Western blot illustrating the effects of treatment with cancer cell-derived conditioned medium (CM) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. TGF-beta 1 treatment (1 & 10 ng/ml) was included as a positive control. Tubulin was used as loading control (A, B). Image collected & cropped by CiteAb from the following publication (//www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-84971_rabbit-polyclonal-biglycan-antibody-310202415394533.jpg "Western Blot: Biglycan Antibody [NBP1-84971] - Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. (B) Western blot illustrating the effects of treatment with cancer cell-derived conditioned medium (CM) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. TGF-beta 1 treatment (1 & 10 ng/ml) was included as a positive control. Tubulin was used as loading control (A, B). Image collected & cropped by CiteAb from the following publication (//www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Biglycan Antibody [NBP1-84971] - Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. (B) Western blot illustrating the effects of treatment with cancer cell-derived conditioned medium (CM) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. TGF-beta 1 treatment (1 & 10 ng/ml) was included as a positive control. Tubulin was used as loading control (A, B). Image collected & cropped by CiteAb from the following publication (//www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-84971_rabbit-polyclonal-biglycan-antibody-310202415392538.jpg "Western Blot: Biglycan Antibody [NBP1-84971] - Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. (B) Western blot illustrating the effects of treatment with cancer cell-derived conditioned medium (CM) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. TGF-beta 1 treatment (1 & 10 ng/ml) was included as a positive control. Tubulin was used as loading control (A, B). Image collected & cropped by CiteAb from the following publication (//www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/Versican_AF3054_Immunocytochemistry_6488.jpg)
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/af3054_human-versican-affinity-purified-polyclonal-ab-immunocytochemistry-842022131824.jpg)
![Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images/af3054_human-versican-affinity-purified-polyclonal-ab-22820241723618.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/PlGF_DPG00_ELISA_158.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_788.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_789.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Simple Western Prostaglandin I2 Synthase Antibody (852307) [Unconjugated]](https://images.novusbio.com/images2/PTGIS_MAB7788_Simple_Western_17148.jpg)
![Western Blot Prostaglandin I2 Synthase Antibody (852307) [Unconjugated]](https://images.novusbio.com/images2/PTGIS_MAB7788_Western_Blot_13067.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")