![Western Blot: ATG14 Antibody [NBP3-04664] - analysis of extracts of various cell lines, using ATG14 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/antibody/nbp3-04664_rabbit-polyclonal-atg14-antibody-western-blot-3052024111410..jpg "Western Blot: ATG14 Antibody [NBP3-04664] - analysis of extracts of various cell lines, using ATG14 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 340-440 of human ATG14 (NP_055739.2). SKQKFTRAVKKLNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESGDERVSDEETDLGTDWENLPS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ATG14 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 55 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ATG14 Antibody (NBP3-04664)Find related products by research area.
|
|
Animal Models to Study Autophagy By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the... Read full blog post. |
|
Beclin 2, a mammal-specific homolog of Beclin 1 with unique functional similarities and differences Beclin 2 (BECN2) is also called Beclin-1-like protein 1/ BECN1P1 and it was recently identified by He et al 2013 as a mammal-specific homolog of the evolutionarily conserved protein Beclin 1 which is well established for its role in the regulation ... Read full blog post. |
|
ATG9A - early marker autophagosome assembly ATG9A is the only essential integral membrane protein involved in autophagy. ATG9A contains six transmembrane domains and initiates the assembly of autophagosomes. The autophagosome is a double-membrane structure that engulfs and eventually degrade... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ATG14 |
![Western Blot: ATG14 Antibody [NBP3-04664] - Analysis of extracts of Neuro-2a cells, using ATG14 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/antibody/nbp3-04664_rabbit-polyclonal-atg14-antibody-western-blot-3052024111545..jpg "Western Blot: ATG14 Antibody [NBP3-04664] - Analysis of extracts of Neuro-2a cells, using ATG14 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.")
![Immunocytochemistry/Immunofluorescence: ATG14 Antibody [NBP3-04664] - Analysis of U2OS cells using ATG14 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/antibody/nbp3-04664_rabbit-polyclonal-atg14-antibody-immunocytochemistry-immunofluorescence-3052024111725..jpg "Immunocytochemistry/Immunofluorescence: ATG14 Antibody [NBP3-04664] - Analysis of U2OS cells using ATG14 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunocytochemistry__Immunofluorescence_17382.jpg)
![Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunohistochemistry_23316.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")