![Western Blot: ZFYVE1 Antibody [NBP1-84267] - Analysis in human cell line RT-4.](http://images.novusbio.com/fullsize/ZFYVE1-Antibody-Western-Blot-NBP1-84267-img0005.jpg "Western Blot: ZFYVE1 Antibody [NBP1-84267] - Analysis in human cell line RT-4.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IAPAYWRPNSQILSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILHCHNCRKEFSIKLSKHH |
| Predicted Species | Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZFYVE1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZFYVE1 |
![Immunocytochemistry/Immunofluorescence: ZFYVE1 Antibody [NBP1-84267] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ZFYVE1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84267-img0007.jpg "Immunocytochemistry/Immunofluorescence: ZFYVE1 Antibody [NBP1-84267] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ZFYVE1 Antibody [NBP1-84267] - Staining of human testis shows moderate positivity in cytoplasm granular in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ZFYVE1-Antibody-Immunohistochemistry-Paraffin-NBP1-84267-img0010.jpg "Immunohistochemistry-Paraffin: ZFYVE1 Antibody [NBP1-84267] - Staining of human testis shows moderate positivity in cytoplasm granular in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: ZFYVE1 Antibody [NBP1-84267] - Staining of human cerebellum shows moderate positivity in cytoplasm granular in Purkinje cells.](http://images.novusbio.com/fullsize/ZFYVE1-Antibody-Immunohistochemistry-Paraffin-NBP1-84267-img0008.jpg "Immunohistochemistry-Paraffin: ZFYVE1 Antibody [NBP1-84267] - Staining of human cerebellum shows moderate positivity in cytoplasm granular in Purkinje cells.")
![Immunohistochemistry-Paraffin: ZFYVE1 Antibody [NBP1-84267] - Staining of human kidney shows strong positivity in cytoplasm granular in cells in tubules.](http://images.novusbio.com/fullsize/ZFYVE1-Antibody-Immunohistochemistry-Paraffin-NBP1-84267-img0009.jpg "Immunohistochemistry-Paraffin: ZFYVE1 Antibody [NBP1-84267] - Staining of human kidney shows strong positivity in cytoplasm granular in cells in tubules.")
![Immunohistochemistry FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Immunohistochemistry_6835.jpg)
![Knockout Validated FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Knockout_Validated_22783.jpg)
![Western Blot FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/af4467_human-mouse-rat-fak-affinity-purified-polyclonal-ab-western-blot-116202015471.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")