![Western Blot: ARID1B Antibody [NBP3-35563] - Western blot analysis of various lysates using ARID1B Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.](http://images.novusbio.com/fullsize/nbp3-35563_rabbit-arid1b-pab-912202415152877.jpg "Western Blot: ARID1B Antibody [NBP3-35563] - Western blot analysis of various lysates using ARID1B Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 400-650 of human ARID1B (NP_059989.2). Sequence: GGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPPSQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQQSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQMPPQYGQQGVSGYCQQGQQPYYSQQPQPPHLPPQAQYLPSQSQQRYQPQQDMSQEGYGTRSQPPLAPGKPN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARID1B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 244 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ARID1B |
![Immunohistochemistry: ARID1B Antibody [NBP3-35563] - Immunohistochemistry analysis of paraffin-embedded Human breast using ARID1B Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35563_rabbit-arid1b-pab-9122024151957.jpg "Immunohistochemistry: ARID1B Antibody [NBP3-35563] - Immunohistochemistry analysis of paraffin-embedded Human breast using ARID1B Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: ARID1B Antibody [NBP3-35563] - Immunofluorescence analysis of C6 cells using ARID1B Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-35563_rabbit-arid1b-pab-912202415175263.jpg "Immunocytochemistry/ Immunofluorescence: ARID1B Antibody [NBP3-35563] - Immunofluorescence analysis of C6 cells using ARID1B Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry: ARID1B Antibody [NBP3-35563] - Immunohistochemistry analysis of paraffin-embedded Rat heart using ARID1B Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35563_rabbit-arid1b-pab-9122024159584.jpg "Immunohistochemistry: ARID1B Antibody [NBP3-35563] - Immunohistochemistry analysis of paraffin-embedded Rat heart using ARID1B Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: ARID1B Antibody [NBP3-35563] - Immunofluorescence analysis of U-2 OS cells using ARID1B Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-35563_rabbit-arid1b-pab-912202414123865.jpg "Immunocytochemistry/ Immunofluorescence: ARID1B Antibody [NBP3-35563] - Immunofluorescence analysis of U-2 OS cells using ARID1B Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry: ARID1B Antibody [NBP3-35563] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using ARID1B Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35563_rabbit-arid1b-pab-912202415171188.jpg "Immunohistochemistry: ARID1B Antibody [NBP3-35563] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using ARID1B Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunohistochemistry FGFR3 Antibody (136312) [Unconjugated] - (IIIc)](https://images.novusbio.com/images2/FGF_R3_MAB7662_Immunohistochemistry_23319.jpg)
![Flow Cytometry FGFR3 Antibody (136312) [Unconjugated] - (IIIc)](https://images.novusbio.com/images2/mab7662_human-fgf-r3-iiic-mab-clone-136312-flow-cytometry-2112202112199.jpg)
![Immunocytochemistry FGFR3 Antibody (136312) [Unconjugated] - (IIIc)](https://images.novusbio.com/images2/mab7662_human-fgf-r3-iiic-mab-clone-136312-immunocytochemistry-186202172236.jpg)
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")