Home » ARHGEF7 » ARHGEF7 Proteins » ARHGEF7 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ARHGEF7 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ARHGEF7 Protein (NBP1-88650PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

ARHGEF7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARHGEF7.

Source: E. coli

Amino Acid Sequence: RMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARHGEF7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88650.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARHGEF7 Recombinant Protein Antigen

  • Beta-Pix
  • COOL1COOL-1
  • DKFZp686C12170
  • DKFZp761K1021
  • guanine nucleotide exchange factor 7
  • KIAA0142KIAA0412
  • Nbla10314
  • P50
  • P50BP
  • P85
  • P85COOL1
  • P85SPRBETA-PIX
  • PAK3
  • PAK3BP
  • PIXBPAK-interacting exchange factor beta
  • Rho guanine nucleotide exchange factor (GEF) 7
  • rho guanine nucleotide exchange factor 7
  • SH3 domain-containing proline-rich protein

Background

ARHGEF7, also known as Rho guanine nucleotide exchange factor 7, contains many isoforms that are 90 kDa, 87 kDa, 84 kDa, 82 kDa, 73 kDa, and 70 kDa, and is involved in apoptosis regulation, cell migration, and cell spreading. Current disease research is being conducted on ARHGEF7 and its relation to Borjeson-Forssmann-Lehmann Syndrome, t-cell leukemia, breast cancer, Wiskott-Aldrich Syndrome, insulin resistance, neuronitis, pancreatitis, leukemia, neuroblastoma, insulin resistance, adenocarcinoma, and lung cancer. This protein is linked to the GPCR pathway and the RhoA pathway, and it interacts with SCRIB, CBL, GIT1, PAK1, and CBLB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
(94 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Synaptotagmin 1
Antibody (ASV48) [Unc ...
MAB4364
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
(1 Publication)
Species: Rt
Applications: ICC, IHC, IP, KO, WB
WNK1 Antibody
[Unconjugated]
AF2849
Western Blot WNK1 Antibody [Unconjugated]
(5 Publications)
Species: Mu, Rt
Applications: WB
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Flow Cytometry GRASP65 Antibody (OTI5G8)
(3 Reviews)
(2 Publications)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
c-Rel Antibody
[Unconjugated]
AF2699
Western Blot c-Rel Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) c-Rel Antibody [Unconjugated]
Simple Western c-Rel Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, Simple Western, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
IRS1 Antibody
NB100-82001
Immunohistochemistry-Paraffin IRS1 Antibody
Western Blot IRS1 Antibody
Immunocytochemistry/ Immunofluorescence IRS1 Antibody
(4 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
NFkB2/NFkB p100
Antibody
NBP1-87760
Immunohistochemistry-Paraffin NFkB2/NFkB p100 Antibody
Immunohistochemistry-Paraffin NFkB2/NFkB p100 Antibody
Immunohistochemistry-Paraffin NFkB2/NFkB p100 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot CDP/CUTL1 Antibody (2A10)
Immunohistochemistry-Paraffin CDP/CUTL1 Antibody (2A10)
ELISA CDP/CUTL1 Antibody (2A10)
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(18 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(631 Publications)
Species: Mu
Applications: ELISA
SART3 Antibody
NB100-74648
Immunohistochemistry-Paraffin SART3 Antibody
Immunohistochemistry-Paraffin SART3 Antibody
Western Blot SART3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for ARHGEF7 Protein (NBP1-88650PEP) (0)

There are no publications for ARHGEF7 Protein (NBP1-88650PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF7 Protein (NBP1-88650PEP) (0)

There are no reviews for ARHGEF7 Protein (NBP1-88650PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ARHGEF7 Protein (NBP1-88650PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARHGEF7 Products

Research Areas for ARHGEF7 Protein (NBP1-88650PEP)

Find related products by research area.

Blogs on ARHGEF7

There are no specific blogs for ARHGEF7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ARHGEF7 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ARHGEF7