![Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868] - ASS1 was successfully silenced in H4-II-E-C3 cells. Image from verified customer review.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Western-Blot-NBP1-88868-img0013.jpg "Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868] - ASS1 was successfully silenced in H4-II-E-C3 cells. Image from verified customer review.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDG |
| Predicted Species | Mouse (95%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ASS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Rat | 03/08/2018 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Argininosuccinate Synthase Antibody (NBP1-88868)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ASS1 |
![Immunocytochemistry/Immunofluorescence: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88868-img0007.jpg "Immunocytochemistry/Immunofluorescence: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human skin shows moderate cytoplasmic positivity in a subset of squamous epithelial cells.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0023.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human skin shows moderate cytoplasmic positivity in a subset of squamous epithelial cells.")
![Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Western-Blot-NBP1-88868-img0005.jpg "Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
![Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868] - Analysis in human cell lines MCF-7 and U-251MG using anti-ASS1 antibody. Corresponding ASS1 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Western-Blot-NBP1-88868-img0012.jpg "Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868] - Analysis in human cell lines MCF-7 and U-251MG using anti-ASS1 antibody. Corresponding ASS1 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0008.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0009.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining in human kidney and lymph node tissues using anti-ASS1 antibody. Corresponding ASS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0010.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining in human kidney and lymph node tissues using anti-ASS1 antibody. Corresponding ASS1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human kidney, liver, lymph node and urinary bladder using Anti-ASS1 antibody NBP1-88868 (A) shows similar protein distribution across tissues to independent antibody NBP1-88867 (B).](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0014.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human kidney, liver, lymph node and urinary bladder using Anti-ASS1 antibody NBP1-88868 (A) shows similar protein distribution across tissues to independent antibody NBP1-88867 (B).")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human urinary bladder.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0015.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human urinary bladder.")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human kidney using Anti-ASS1 antibody NBP1-88868.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0017.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human kidney using Anti-ASS1 antibody NBP1-88868.")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human lymph node using Anti-ASS1 antibody NBP1-88868.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0018.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human lymph node using Anti-ASS1 antibody NBP1-88868.")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Analysis in human kidney and lymph node tissues using NBP1-88868 antibody. Corresponding ASS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0019.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Analysis in human kidney and lymph node tissues using NBP1-88868 antibody. Corresponding ASS1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human kidney, liver, lymph node and skin using Anti-ASS1 antibody NBP1-88868 (A) shows similar protein distribution across tissues to independent antibody NBP1-88867 (B).](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0020.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human kidney, liver, lymph node and skin using Anti-ASS1 antibody NBP1-88868 (A) shows similar protein distribution across tissues to independent antibody NBP1-88867 (B).")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0021.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human lymph node shows no cytoplasmic positivity in germinal center cells as expected.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0022.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human lymph node shows no cytoplasmic positivity in germinal center cells as expected.")
![Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://images.novusbio.com/fullsize/Argininosuccinate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-88868-img0024.jpg "Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.")
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
