Home » Annexin A2 » Annexin A2 Proteins » Annexin A2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Annexin A2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Annexin A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANXA2.

Source: E. coli

Amino Acid Sequence: MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ANXA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62614.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Annexin A2 Recombinant Protein Antigen

  • Annexin A2
  • Annexin II
  • annexin-2
  • ANX2
  • ANX2L4
  • ANX2L4LPC2
  • ANXA2
  • CAL1H
  • Calpactin I heavy chain
  • calpactin I heavy polypeptide
  • Calpactin-1 heavy chain
  • chromobindin 8
  • chromobindin-8
  • LIP2
  • LIP2PAP-IV
  • Lipocortin II
  • Lipocortin-2
  • LPC2D
  • LPC2DP36
  • p36
  • PAP-IV
  • Placental anticoagulant protein IV
  • Protein I

Background

The Annexins are a family of structurally similar proteins. Annexins bind to phospholipids and may be involved in regulation of membrane transport, membrane channel activity, and interaction of the cell membrane with the extracellular matrix. Annexin II is a calcium regulated, membrane binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

S100A10 Antibody
[Unconjugated]
AF2377
Western Blot S100A10 Antibody [Unconjugated]
Immunohistochemistry S100A10 Antibody [Unconjugated]
Simple Western S100A10 Antibody [Unconjugated]
(20 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
P11 Antibody
NBP1-82458
Immunohistochemistry-Paraffin P11 Antibody
Immunohistochemistry-Paraffin P11 Antibody
Immunohistochemistry-Paraffin P11 Antibody
Species: Hu
Applications: IHC, IHC-P
Exosome component
6 Antibody
NBP1-57508
Western Blot Exosome component 6 Antibody
Immunohistochemistry-Paraffin Exosome component 6 Antibody
Immunohistochemistry-Paraffin Exosome component 6 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Annexin A1
Antibody [Unconjugate
AF3770
Western Blot Annexin A1 Antibody [Unconjugated]
Immunohistochemistry Annexin A1 Antibody [Unconjugated]
Simple Western Annexin A1 Antibody [Unconjugated]
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Plasminogen
Antibody
NB600-930
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
(2 Reviews)
(6 Publications)
Species: Hu, Rt
Applications: ELISA, WB
t-Plasminogen
Activator/tPA [HRP]
DTPA00
N/A t-Plasminogen Activator/tPA [HRP]
N/A t-Plasminogen Activator/tPA [HRP]
(7 Publications)
Species: Hu
Applications: ELISA
Annexin V
Apoptosis Kit [FITC]
NBP2-29373
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
Annexin A4 Antibody
AF4146
Immunohistochemistry Annexin A4 Antibody
Western Blot Annexin A4 Antibody
(7 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
Annexin A6 Antibody
NBP1-90149
Western Blot Annexin A6 Antibody
Immunohistochemistry-Paraffin Annexin A6 Antibody
Immunohistochemistry-Paraffin Annexin A6 Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(635 Publications)
Species: Mu
Applications: ELISA
CDK5 Activator 1
Antibody
NBP3-13279
Immunocytochemistry/ Immunofluorescence CDK5 Activator 1 Antibody
Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody
Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
S100B Antibody
NBP1-87102
Immunocytochemistry/ Immunofluorescence S100B Antibody
Immunohistochemistry-Paraffin S100B Antibody
Immunohistochemistry-Paraffin S100B Antibody
(14 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
S100A1 Antibody
NBP1-87103
Western Blot S100A1 Antibody
Immunohistochemistry-Paraffin S100A1 Antibody
Immunohistochemistry-Paraffin S100A1 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
PLA2G1B Antibody
(630823)
MAB5018
Western Blot PLA2G1B Antibody (630823)
Species: Hu
Applications: IP, WB
Cyclin H Antibody
(1B8)
H00000902-M01
Western Blot Cyclin H Antibody (1B8)
Immunocytochemistry/ Immunofluorescence Cyclin H Antibody (1B8)
Immunohistochemistry-Paraffin Cyclin H Antibody (1B8)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB

Publications for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP) (0)

There are no publications for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP) (0)

There are no reviews for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Annexin A2 Products

Research Areas for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP)

Find related products by research area.

Blogs on Annexin A2.

Check out the latest blog posts on Annexin A2.
Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness
By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax...  Read full blog post.
Integrin Beta 1/CD29 - a cell adhesion and cell signaling protein with diverse functions
Integrins are a large family of trasmembrane proteins involved in cell adhesion and form a link between the intracellular cyskeletal proteins and extracellular matrix proteins. Integrins exist as heterodimers consisting of alpha and beta subunits. ...  Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunocytochemistry/Immunofluorescence: Annexin A2 Antibody (1G7) [H00000302-M02] - Localization of annexin A2 at the focal adhesions: KS1767 cells co-stained for paxillin (FITC-conjugated secondary antibody, green) and annexin A2 (Alexa 647-conjugated secondary antibody, red). An enlarged inset (white dotted line) is included for prompt visualization. Nuclei are visualized with DAPI (blue); scale bar, 10um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-017-03470-w), licensed under a CC-BY license.
Annexin A2 Antibody (1G7)
H00000302-M02
Flow Cytometry: Annexin V Apoptosis Kit [FITC] [NBP2-29373] - Adherent RAW cells treated with actinomycin-D, detached with a cell detachment solution and stained with the Annexin V Apoptosis Kit [FITC].
Annexin V Apoptosis Kit [FITC]
NBP2-29373-100Tests

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Annexin A2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ANXA2