![Western Blot: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human cerebral cortex, colon, kidney and tonsil using Anti-AMPH antibody NBP1-86033 (A) shows similar protein distribution across tissues to independent antibody NBP1-87561 (B).](http://images.novusbio.com/fullsize/Amphiphysin-AMPH-Antibody-Western-Blot-NBP1-86033-img0010.jpg "Western Blot: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human cerebral cortex, colon, kidney and tonsil using Anti-AMPH antibody NBP1-86033 (A) shows similar protein distribution across tissues to independent antibody NBP1-87561 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRL |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AMPH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Amphiphysin/AMPH Antibody (NBP1-86033)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AMPH |
![Immunocytochemistry/Immunofluorescence: Amphiphysin/AMPH Antibody [NBP1-86033] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize/Amphiphysin-AMPH-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86033-img0005.jpg "Immunocytochemistry/Immunofluorescence: Amphiphysin/AMPH Antibody [NBP1-86033] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.")
![Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human colon.](http://images.novusbio.com/fullsize/Amphiphysin-AMPH-Antibody-Immunohistochemistry-Paraffin-NBP1-86033-img0012.jpg "Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human colon.")
![Western Blot: Amphiphysin/AMPH Antibody [NBP1-86033] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-34](http://images.novusbio.com/fullsize/Amphiphysin-AMPH-Antibody-Western-Blot-NBP1-86033-img0004.jpg "Western Blot: Amphiphysin/AMPH Antibody [NBP1-86033] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-34")
![Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells, cells of molecular and granular layer.](http://images.novusbio.com/fullsize/Amphiphysin-AMPH-Antibody-Immunohistochemistry-Paraffin-NBP1-86033-img0006.jpg "Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells, cells of molecular and granular layer.")
![Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/Amphiphysin-AMPH-Antibody-Immunohistochemistry-Paraffin-NBP1-86033-img0007.jpg "Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human tonsil shows low expression as expected.](http://images.novusbio.com/fullsize/Amphiphysin-AMPH-Antibody-Immunohistochemistry-Paraffin-NBP1-86033-img0008.jpg "Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human tonsil shows low expression as expected.")
![Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining in human cerebral cortex and tonsil tissues using anti-AMPH antibody. Corresponding AMPH RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Amphiphysin-AMPH-Antibody-Immunohistochemistry-Paraffin-NBP1-86033-img0009.jpg "Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining in human cerebral cortex and tonsil tissues using anti-AMPH antibody. Corresponding AMPH RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human kidney.](http://images.novusbio.com/fullsize/Amphiphysin-AMPH-Antibody-Immunohistochemistry-Paraffin-NBP1-86033-img0011.jpg "Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human kidney.")
![FXR/NR1H4 Antibody (A9033A) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FXR/NR1H4 Antibody (A9033A) [Unconjugated]")
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")