ALK-7/Activin Receptor Type 1C Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHL |
Predicted Species |
Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ACVR1C |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for ALK-7/Activin Receptor Type 1C Antibody
Background
ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type Ireceptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interactdirectly with DNA or in complex with other transcription factors (Bondestam et al., 2001 (PubMed 12063393)).(suppliedby OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu
Applications: WB
Publications for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253) (0)
There are no publications for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253) (0)
There are no reviews for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ALK-7/Activin Receptor Type 1C Products
Research Areas for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253)
Find related products by research area.
|
Blogs on ALK-7/Activin Receptor Type 1C