![Western Blot: ALG12 Antibody (5E3) [H00079087-M06] - Analysis of ALG12 expression in HeLa (Cat # L013V1).](http://images.novusbio.com/fullsize/ALG12-Antibody-5E3-Western-Blot-H00079087-M06-img0005.jpg "Western Blot: ALG12 Antibody (5E3) [H00079087-M06] - Analysis of ALG12 expression in HeLa (Cat # L013V1).")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 5E3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ALG12 (NP_077010, 369 a.a. ~ 425 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG |
| Specificity | ALG12 - asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ALG12 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ALG12 Antibody (5E3) [H00079087-M06] - Analysis of ALG12 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/fullsize/ALG12-Antibody-5E3-Western-Blot-H00079087-M06-img0006.jpg "Western Blot: ALG12 Antibody (5E3) [H00079087-M06] - Analysis of ALG12 expression in PC-12 (Cat # L012V1).")
![Sandwich ELISA: ALG12 Antibody (5E3) [H00079087-M06] - Detection limit for recombinant GST tagged ALG12 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ALG12-Antibody-5E3-Sandwich-ELISA-H00079087-M06-img0004.jpg "Sandwich ELISA: ALG12 Antibody (5E3) [H00079087-M06] - Detection limit for recombinant GST tagged ALG12 is approximately 0.3ng/ml as a capture antibody.")
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")