PIGB Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QRGTLDVMSHIQKVCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEAD |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PIGB |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PIGB Antibody
Background
PIGB, also referred to as GPI mannosyltransferase 3, is 554 amino acids long and is approximately 65 kDa. PIGB is a mannosyltransferase that is implicated in the biosynthesis of GPI anchors. Current research on PIGB is being performed relating to several diseases and disorders including malaria, sleeping sickness, Griscelli syndrome and encephalomalacia. PIGB has also been shown to have interactions with TMED10, CDC40, DNAJA1, FNBP1L and EEF1A1 in pathways such as GPI anchor biosynthesis and metabolic pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ch, Fi, Hu, Pm, Mu, Rt, Re, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, WB
Publications for PIGB Antibody (NBP1-85856) (0)
There are no publications for PIGB Antibody (NBP1-85856).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PIGB Antibody (NBP1-85856) (0)
There are no reviews for PIGB Antibody (NBP1-85856).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PIGB Antibody (NBP1-85856) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PIGB Products
Blogs on PIGB