AF10 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSV |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MLLT10 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (85%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for AF10 Antibody
Background
AF10 is a putative transcription factor containing a leucine zipper motif. A t(10;11)(p12;q23) chromosomal translocation present in a proportion of acute myeloid leukaemias results in expression of an AF10 (carboxy terminus) MLL (amino terminus) fusion protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Fe, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: CHIP-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, KO, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for AF10 Antibody (NBP1-90222) (0)
There are no publications for AF10 Antibody (NBP1-90222).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AF10 Antibody (NBP1-90222) (0)
There are no reviews for AF10 Antibody (NBP1-90222).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AF10 Antibody (NBP1-90222) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AF10 Products
Blogs on AF10