Home » ACSBG1 » ACSBG1 Proteins » ACSBG1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ACSBG1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ACSBG1 Protein (NBP2-31990PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ACSBG1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACSBG1.

Source: E. coli

Amino Acid Sequence: ANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACSBG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31990.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ACSBG1 Recombinant Protein Antigen

  • acyl-CoA synthetase bubblegum family member 1EC 6.2.1.3
  • BG1
  • BGMBG
  • bubblegum
  • FLJ30320
  • hBG1
  • hsBG
  • hsBGM
  • KIAA0631GR-LACS
  • lipidosin
  • long-chain-fatty-acid--CoA ligase ACSBG1
  • LPD
  • MGC14352
  • very long-chain acyl-CoA synthetase

Background

ACSBG1 (Acyl CoA synthetase bubblegum family member 1) possesses long-chain acyl-CoA synthetase activity. It mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is thought to play a central role in brain very long-chain fatty acids metabolism and myelinogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
MGMT Antibody (MT
23.2) - BSA Free
NB100-168
Flow (Intracellular) MGMT Antibody (MT 23.2) - BSA Free
Flow Cytometry MGMT Antibody (MT 23.2) - BSA Free
Flow (Intracellular) MGMT Antibody (MT 23.2) - BSA Free
(21 Publications)
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AGXT Antibody
NBP1-89200
Immunohistochemistry-Paraffin AGXT Antibody
Immunohistochemistry-Paraffin AGXT Antibody
Immunohistochemistry-Paraffin AGXT Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB

beta-Glucuronidase/GUS
NBP1-87511
Immunocytochemistry/ Immunofluorescence beta-Glucuronidase/GUSB Antibody
Immunohistochemistry-Paraffin beta-Glucuronidase/GUSB Antibody
Immunohistochemistry-Paraffin beta-Glucuronidase/GUSB Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Immunocytochemistry/ Immunofluorescence Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]
Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]
(1 Review)
(14 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(450 Publications)
Species: Hu
Applications: BA
HPD Antibody
NBP1-89366
Western Blot HPD Antibody
Western Blot HPD Antibody
Immunohistochemistry-Paraffin HPD Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
EEF1A2 Antibody
NBP2-33280
Immunohistochemistry-Paraffin EEF1A2 Antibody
Immunohistochemistry-Paraffin EEF1A2 Antibody
Immunohistochemistry-Paraffin EEF1A2 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(643 Publications)
Species: Mu
Applications: ELISA
PSMA1 Antibody
NBP1-81768
Immunocytochemistry/ Immunofluorescence PSMA1 Antibody
Western Blot PSMA1 Antibody
Immunohistochemistry-Paraffin PSMA1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
(1 Publication)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(374 Publications)
Species: Hu
Applications: BA
ACSBG1 Recombinant
Protein Antigen
NBP2-31990PEP
ACSBG1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ACSBG1 Protein (NBP2-31990PEP) (0)

There are no publications for ACSBG1 Protein (NBP2-31990PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSBG1 Protein (NBP2-31990PEP) (0)

There are no reviews for ACSBG1 Protein (NBP2-31990PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ACSBG1 Protein (NBP2-31990PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACSBG1 Products

Research Areas for ACSBG1 Protein (NBP2-31990PEP)

Find related products by research area.

Blogs on ACSBG1

There are no specific blogs for ACSBG1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ACSBG1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ACSBG1