ABCA4 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: IQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEET |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ABCA4 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for ABCA4 Antibody
Background
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This protein is a retina-specific ABC transporter with N-retinylidene-PE as a substrate. It is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Mutations in this gene are found in patients diagnosed with Stargardt disease, a form of juvenile-onset macular degeneration. Mutations in this gene are also associated with retinitis pigmentosa-19, cone-rod dystrophy type 3, early-onset severe retinal dystrophy, fundus flavimaculatus, and macular degeneration age-related 2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC
Publications for ABCA4 Antibody (NBP3-17333) (0)
There are no publications for ABCA4 Antibody (NBP3-17333).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ABCA4 Antibody (NBP3-17333) (0)
There are no reviews for ABCA4 Antibody (NBP3-17333).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ABCA4 Antibody (NBP3-17333) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ABCA4 Products
Research Areas for ABCA4 Antibody (NBP3-17333)
Find related products by research area.
|
Blogs on ABCA4