Novus Biologicals products are now on bio-techne.com

Viperin Recombinant Protein Antigen

Name: Viperin Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84467PEP
Price: 289 USD

Images

There are currently no images for Viperin Protein (NBP1-84467PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

Viperin Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RSAD2. Source: E. coli Amino Acid Sequence: EAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	RSAD2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84467. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Viperin Recombinant Protein Antigen

2510004L01Rik
cig33
cig5
Cytomegalovirus-induced gene 5 protein
interferon-inducible
radical S-adenosyl methionine domain containing 2
radical S-adenosyl methionine domain-containing protein 2
vig1
viperin
Virus inhibitory protein, endoplasmic reticulum-associated

Background

Viperin is involved in antiviral defense. May impair virus budding by disrupting lipid rafts at the plasma membrane, afeature which is essential for the budding process of many viruses. Acts through binding with and inactivating FPPS,an enzyme involved in synthesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IFN-alpha 1
Antibody

NBP2-75930

Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

MxA/Mx1 Antibody

NBP1-32905

(1 Review)

(1 Publication)

Species: Bv, Hu, Pm, Rb

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

ISG15/UCRP
[7-Amino-4-Methyl Cou

UL-553

(12 Publications)

Species: Hu

Applications: EnzAct

IFIT1 Antibody
(OTI3G8)

NBP2-02340

(1 Publication)

Species: Hu, Pm, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

IFN-beta
[Unconjugated]

8499-IF

(54 Publications)

Species: Hu

Applications: BA

TLR3 Antibody
(40C1285.6) - BSA Fre

NBP2-24875

Western Blot TLR3 Antibody (40C1285.6) - BSA Free

(90 Publications)

Species: Ca, Hu, Mu

Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB

BLIMP1/PRDM1
Antibody (3H2-E8) - B ...

NB600-235

Flow Cytometry BLIMP1/PRDM1 Antibody (3H2-E8) - BSA Free

(2 Reviews)

(52 Publications)

Species: Hu, Mu, Po

Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

IRF3 Antibody
(SD2062)

NBP2-67741

Immunohistochemistry-Paraffin IRF3 Antibody (SD2062)

(2 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

IRF7 Antibody
(SC0617)

NBP2-67634

Immunohistochemistry-Paraffin IRF7 Antibody (SC0617)

(1 Publication)

Species: Hu, Mu, Rt, Ze

Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

NFkB p105/p50
Antibody (2J10D7) - B ...

NB100-56583

(1 Review)

(5 Publications)

Species: Hu, Rb, Rt

Applications: Flow, IHC, IHC-P, KO, Simple Western, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(821 Publications)

Species: Hu

Applications: BA

CXCL10/IP-10/CRG-2
[HRP]

DIP100

(155 Publications)

Species: Hu

Applications: ELISA

RIG-I Antibody

AF4859

(2 Publications)

Species: Hu

Applications: WB

IRF1 Antibody
[Unconjugated]

AF4715

(1 Review)

(2 Publications)

Species: Mu

Applications: WB

STAT1 [p Tyr701]
Antibody [Unconjugate ...

AF2894

Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]

Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]

(1 Review)

(11 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, ICFlow, Simple Western, WB

Cathepsin L
Antibody [Unconjugate

AF952

Immunohistochemistry Cathepsin L Antibody [Unconjugated]

(27 Publications)

Species: Hu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB

VAP-A Antibody

NBP1-31237

Immunohistochemistry-Paraffin VAP-A Antibody

(5 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

c-jun [p Ser63]
Antibody (1018Y) [Unc ...

MAB8930

Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]

Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]

(1 Review)

(3 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

MAVS Antibody -
BSA Free

NB100-80859

Immunohistochemistry-Paraffin MAVS Antibody - BSA Free

(1 Review)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

DHX58 Antibody

NBP1-85348

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

Publications for Viperin Protein (NBP1-84467PEP) (0)

There are no publications for Viperin Protein (NBP1-84467PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Viperin Protein (NBP1-84467PEP) (0)

There are no reviews for Viperin Protein (NBP1-84467PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Viperin Protein (NBP1-84467PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Viperin Products

Research Areas for Viperin Protein (NBP1-84467PEP)

Find related products by research area.

Immunology

Blogs on Viperin.

Check out the latest blog posts on Viperin.

Viperin: A Cellular Inhibitor of DNA and RNA Viruses
Viperin (Virus Inhibitory Protein, Endoplasmic Reticulum-associated, Interferon-inducible) inhibits the replication of a broad spectrum of viruses by several diverse mechanisms. The protein was first identified in 2001, when it was found to be the pro... Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Viperin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

RSAD2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Viperin Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Viperin Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Viperin Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Viperin Protein (NBP1-84467PEP) (0)

Reviews for Viperin Protein (NBP1-84467PEP) (0)

FAQs for Viperin Protein (NBP1-84467PEP) (0)

Additional Viperin Products

Research Areas for Viperin Protein (NBP1-84467PEP)

Blogs on Viperin.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics