![Western Blot: Uroplakin Ib Antibody [NBP1-80656] - Analysis of Uroplakin Ib antibody. Lane M: Protein marker Lane 1: UMUC1 cell lysates 30 ug Lane 2: RT112 cell lysates 30 ug. Image from verified customer review.](http://images.novusbio.com/fullsize/Uroplakin-Ib-Antibody-Western-Blot-NBP1-80656-img0007.jpg "Western Blot: Uroplakin Ib Antibody [NBP1-80656] - Analysis of Uroplakin Ib antibody. Lane M: Protein marker Lane 1: UMUC1 cell lysates 30 ug Lane 2: RT112 cell lysates 30 ug. Image from verified customer review.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UPK1B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Uroplakin Ib antibody validated for IHC-P from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Ming Lu |
WB | Human | 01/20/2023 |
Summary
|
|||||||||||
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Mouse | 01/17/2020 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Uroplakin Ib Antibody (NBP1-80656)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Ming Lu 01/20/2023 |
||
| Application: | WB | |
| Species: | Human |
| Verified Customer 01/17/2020 |
||
| Application: | IHC-P | |
| Species: | Mouse |
![Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80656] - UPK 1b positive staining (brown) of murine bladder epithelium, 4% paraformaldehyde fixation, paraffin embedding, and pH 6 HEIR retrieval method and DAB kit used. IHC-P image of mouse submitted by a verified customer review.](http://images.novusbio.com/fullsize/Uroplakin-Ib-Antibody-Immunohistochemistry-Paraffin-NBP1-80656-img0006.jpg "Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80656] - UPK 1b positive staining (brown) of murine bladder epithelium, 4% paraformaldehyde fixation, paraffin embedding, and pH 6 HEIR retrieval method and DAB kit used. IHC-P image of mouse submitted by a verified customer review.")
![Western Blot: Uroplakin Ib Antibody [NBP1-80656] - Analysis in control (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Uroplakin-Ib-Antibody-Western-Blot-NBP1-80656-img0005.jpg "Western Blot: Uroplakin Ib Antibody [NBP1-80656] - Analysis in control (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80656] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.](http://images.novusbio.com/fullsize/Uroplakin-Ib-Antibody-Immunohistochemistry-Paraffin-NBP1-80656-img0004.jpg "Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80656] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
