uPAR Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PLAUR |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for uPAR Antibody
Background
uPAR (Urokinase plasminogen activator receptor) is a glycoprotein I anchored surface receptor specific for urokinase plasminogen activator (uPA). Upon binding to uPAR, uPA converts the surface bound, large serum beta globulin plasminogen to plasmin. Plasmin, which is also designated fibrinolysin, is a trypsin-like enzyme that acts on Arg-Lys bonds and induces pericellular proteolysis in fibrin and fibrinogen, and thereby contributes to the systematic activation of the coagulation cascade. uPA and uPAR are known to be overexpressed in mesenchymal and epithelial tumor cells and are required for tumor invasion and metastasis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: PAGE
Species: Hu
Applications: IHC
Publications for uPAR Antibody (NBP2-14711) (0)
There are no publications for uPAR Antibody (NBP2-14711).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for uPAR Antibody (NBP2-14711) (0)
There are no reviews for uPAR Antibody (NBP2-14711).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for uPAR Antibody (NBP2-14711) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional uPAR Products
Research Areas for uPAR Antibody (NBP2-14711)
Find related products by research area.
|
Blogs on uPAR