![Western Blot: TYRP1 Antibody (CL4917) [NBP2-61147] - Western blot analysis in human cell line SK-MEL-30.](http://images.novusbio.com/fullsize/TYRP1-Antibody-CL4917-Western-Blot-NBP2-61147-img0003.jpg "Western Blot: TYRP1 Antibody (CL4917) [NBP2-61147] - Western blot analysis in human cell line SK-MEL-30.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | CL4917 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH |
| Epitope | YSDPTGKYDP |
| Predicted Species | Mouse (91%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TYRP1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TYRP1 Antibody (NBP2-61147)Find related products by research area.
|
|
Winter is coming, and TRPM8 welcomes the cold! TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds. While TRPM8 is best known for its location in peripheral nerve endings, it has functio... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TYRP1 |
![Immunocytochemistry/Immunofluorescence: TYRP1 Antibody (CL4917) [NBP2-61147] - Staining of SK-MEL-30 cells using the Anti-TYRP1 monoclonal antibody, showing specific staining in the vesicles in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).](http://images.novusbio.com/fullsize/TYRP1-Antibody-CL4917-Immunocytochemistry-Immunofluorescence-NBP2-61147-img0004.jpg "Immunocytochemistry/Immunofluorescence: TYRP1 Antibody (CL4917) [NBP2-61147] - Staining of SK-MEL-30 cells using the Anti-TYRP1 monoclonal antibody, showing specific staining in the vesicles in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).")
![Immunohistochemistry: TYRP1 Antibody (CL4917) [NBP2-61147] - Immunohistochemical staining of human skeletal muscle shows no positivity in muscle fibers as expected (negative control).](http://images.novusbio.com/fullsize/TYRP1-Antibody-CL4917-Immunohistochemistry-NBP2-61147-img0002.jpg "Immunohistochemistry: TYRP1 Antibody (CL4917) [NBP2-61147] - Immunohistochemical staining of human skeletal muscle shows no positivity in muscle fibers as expected (negative control).")
![Immunohistochemistry: TYRP1 Antibody (CL4917) [NBP2-61147] - Immunohistochemical staining of human skin shows strong cytoplasmic immunoreactivity in melanocytes.](http://images.novusbio.com/fullsize/TYRP1-Antibody-CL4917-Immunohistochemistry-NBP2-61147-img0001.jpg "Immunohistochemistry: TYRP1 Antibody (CL4917) [NBP2-61147] - Immunohistochemical staining of human skin shows strong cytoplasmic immunoreactivity in melanocytes.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")